APOA1BP Antibody


Western Blot: APOA1BP Antibody [NBP2-30943] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: APOA1BP Antibody [NBP2-30943] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry: APOA1BP Antibody [NBP2-30943] - Staining in human kidney.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

APOA1BP Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRS
Specificity of human APOA1BP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
APOA1BP Protein (NBP2-30943PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for APOA1BP Antibody

  • apolipoprotein A-I binding protein
  • apolipoprotein A-I-binding protein
  • MGC119143
  • MGC119144
  • MGC119145
  • YjeF N-terminal domain-containing protein 1
  • yjeF_N1
  • YJEFN1apoA-I binding protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for APOA1BP Antibody (NBP2-30943) (0)

There are no publications for APOA1BP Antibody (NBP2-30943).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOA1BP Antibody (NBP2-30943) (0)

There are no reviews for APOA1BP Antibody (NBP2-30943). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for APOA1BP Antibody (NBP2-30943) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional APOA1BP Products

Bioinformatics Tool for APOA1BP Antibody (NBP2-30943)

Discover related pathways, diseases and genes to APOA1BP Antibody (NBP2-30943). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOA1BP Antibody (NBP2-30943)

Discover more about diseases related to APOA1BP Antibody (NBP2-30943).

Pathways for APOA1BP Antibody (NBP2-30943)

View related products by pathway.

PTMs for APOA1BP Antibody (NBP2-30943)

Learn more about PTMs related to APOA1BP Antibody (NBP2-30943).

Blogs on APOA1BP

There are no specific blogs for APOA1BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our APOA1BP Antibody and receive a gift card or discount.


Gene Symbol APOA1BP