APOA1BP Antibody

Images

 
Western Blot: APOA1BP Antibody [NBP2-30943] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: APOA1BP Antibody [NBP2-30943] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry: APOA1BP Antibody [NBP2-30943] - Staining in human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APOA1BP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOA1BP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
APOA1BP Protein (NBP2-30943PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APOA1BP Antibody

  • AIBPAI-BP
  • apolipoprotein A-I binding protein
  • apolipoprotein A-I-binding protein
  • MGC119143
  • MGC119144
  • MGC119145
  • YjeF N-terminal domain-containing protein 1
  • yjeF_N1
  • YJEFN1apoA-I binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-46355
Species: Hu
Applications: WB, IHC
NBP1-57716
Species: Hu
Applications: WB
NBP2-30473
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NBP2-13620
Species: Hu
Applications: IHC, IHC-P
NBP1-85131
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-83483
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87916
Species: Hu
Applications: IHC, IHC-P
NBP2-30943
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for APOA1BP Antibody (NBP2-30943) (0)

There are no publications for APOA1BP Antibody (NBP2-30943).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOA1BP Antibody (NBP2-30943) (0)

There are no reviews for APOA1BP Antibody (NBP2-30943). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for APOA1BP Antibody (NBP2-30943) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APOA1BP Products

Bioinformatics Tool for APOA1BP Antibody (NBP2-30943)

Discover related pathways, diseases and genes to APOA1BP Antibody (NBP2-30943). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOA1BP Antibody (NBP2-30943)

Discover more about diseases related to APOA1BP Antibody (NBP2-30943).
 

Pathways for APOA1BP Antibody (NBP2-30943)

View related products by pathway.

PTMs for APOA1BP Antibody (NBP2-30943)

Learn more about PTMs related to APOA1BP Antibody (NBP2-30943).

Blogs on APOA1BP

There are no specific blogs for APOA1BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APOA1BP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOA1BP
Uniprot