Recombinant Human APJ/Apelin receptor Protein

Images

 
SDS-Page: Recombinant Human APJ/Apelin receptor Protein [H00000187-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human APJ/Apelin receptor Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-380 of Human AGTRL1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
APLNR

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human APJ/Apelin receptor Protein

  • AGTRL1
  • AGTRL1HG11
  • angiotensin II receptor-like 1
  • Angiotensin receptor-like 1
  • apelin receptor
  • APJ (apelin) receptor
  • APJ receptor
  • APJ
  • APJFLJ96609
  • APJR
  • APLNR
  • FLJ90771
  • G protein-coupled receptor APJ
  • G-protein coupled receptor APJ
  • G-protein coupled receptor HG11
  • HG11 orphan receptor
  • HG11
  • MGC45246

Background

AGTRL1( AAH32688, 1 a.a. - 381 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31176
Species: Hu
Applications: WB, ELISA, IHC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB699
Species: Hu
Applications: Flow, CyTOF-reported
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-45562
Species: Hu
Applications: WB, Flow, IHC
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00000187-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for APJ/Apelin receptor Recombinant Protein (H00000187-P01) (0)

There are no publications for APJ/Apelin receptor Recombinant Protein (H00000187-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APJ/Apelin receptor Recombinant Protein (H00000187-P01) (0)

There are no reviews for APJ/Apelin receptor Recombinant Protein (H00000187-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APJ/Apelin receptor Recombinant Protein (H00000187-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APJ/Apelin receptor Products

Bioinformatics Tool for APJ/Apelin receptor Recombinant Protein (H00000187-P01)

Discover related pathways, diseases and genes to APJ/Apelin receptor Recombinant Protein (H00000187-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APJ/Apelin receptor Recombinant Protein (H00000187-P01)

Discover more about diseases related to APJ/Apelin receptor Recombinant Protein (H00000187-P01).
 

Pathways for APJ/Apelin receptor Recombinant Protein (H00000187-P01)

View related products by pathway.

PTMs for APJ/Apelin receptor Recombinant Protein (H00000187-P01)

Learn more about PTMs related to APJ/Apelin receptor Recombinant Protein (H00000187-P01).
 

Research Areas for APJ/Apelin receptor Recombinant Protein (H00000187-P01)

Find related products by research area.

Blogs on APJ/Apelin receptor

There are no specific blogs for APJ/Apelin receptor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human APJ/Apelin receptor Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APLNR
Entrez