Recombinant Human APJ/Apelin receptor Protein

Product Discontinued

Recombinant Human APJ/Apelin receptor Protein Summary

• Description: An untagged recombinant protein corresponding to the amino acid sequence of (ABM81770.1) for Human APJ/Apelin receptor
  
  

  Source: Wheat Germ

  Amino Acid Sequence: MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD

• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: APLNR
• Purity: >10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Functional
  • Immunoaffinity Purification
• Theoretical MW: 41.8 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Preservative: No Preservative
• Purity: >10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human APJ/Apelin receptor Protein

• AGTRL1
• AGTRL1HG11
• angiotensin II receptor-like 1
• Angiotensin receptor-like 1
• apelin receptor
• APJ (apelin) receptor
• APJ receptor
• APJ
• APJFLJ96609
• APJR
• APLNR
• FLJ90771
• G protein-coupled receptor APJ
• G-protein coupled receptor APJ
• G-protein coupled receptor HG11
• HG11 orphan receptor
• HG11
• MGC45246

Background

APJ or Apelin Receptor, is an angiotensin-1-like receptor that is expressed abundantly in the corpus callosum and spinal cord. The human apelin receptor has been localized to chromosome 11. In porcine spinal cord, APJ mRNA was detected at a higher level in white matter than in gray matter (Matsumoto et al., 1996). APJ binds apelin, which induces cell acidification (Tatemoto et al., 1998). APJ expression has been reported in blood, brain, spinal cord, and vessel. ESTs have been isolated from brain, head/neck, lung, and placenta libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APLNR