Apc2 Recombinant Protein Antigen

Images

 
There are currently no images for Apc2 Recombinant Protein Antigen (NBP2-58859PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Apc2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human APC2.

Source: E.coli

Amino Acid Sequence: GQLSLLGSDVDGPSLAKAPISAPFVHEGLGVAVGGFPASRHGSPSRSARVPPFNYVPSPMVVAATTDSAAEK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
APC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58859. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Apc2 Recombinant Protein Antigen

  • adenomatosis polyposis coli 2
  • adenomatous polyposis coli like
  • adenomatous polyposis coli protein 2
  • APCL

Background

Apc2 ia a large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the 26S proteasome. Biochemical studies have shown that the vertebrate APC contains eight subunits. The composition of the APC is highly conserved in organisms from yeast to humans. The product of this gene is a component of the complex and shares sequence similarity with a recently identified family of proteins called cullins, which may also be involved in ubiquitin-mediated degradation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-77375
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP2-57669
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45493
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, WB
NBP1-89095
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-61889
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF7558
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-59829
Species: Hu, Mu
Applications: IP, WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-82886
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-56441
Species: Hu, Mu, Rt
Applications: WB
NBP1-77155
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for Apc2 Recombinant Protein Antigen (NBP2-58859PEP) (0)

There are no publications for Apc2 Recombinant Protein Antigen (NBP2-58859PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apc2 Recombinant Protein Antigen (NBP2-58859PEP) (0)

There are no reviews for Apc2 Recombinant Protein Antigen (NBP2-58859PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Apc2 Recombinant Protein Antigen (NBP2-58859PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apc2 Products

Array NBP2-58859PEP

Bioinformatics Tool for Apc2 Recombinant Protein Antigen (NBP2-58859PEP)

Discover related pathways, diseases and genes to Apc2 Recombinant Protein Antigen (NBP2-58859PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apc2 Recombinant Protein Antigen (NBP2-58859PEP)

Discover more about diseases related to Apc2 Recombinant Protein Antigen (NBP2-58859PEP).
 

Pathways for Apc2 Recombinant Protein Antigen (NBP2-58859PEP)

View related products by pathway.

PTMs for Apc2 Recombinant Protein Antigen (NBP2-58859PEP)

Learn more about PTMs related to Apc2 Recombinant Protein Antigen (NBP2-58859PEP).
 

Research Areas for Apc2 Recombinant Protein Antigen (NBP2-58859PEP)

Find related products by research area.

Blogs on Apc2

There are no specific blogs for Apc2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Apc2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol APC2