Apc11 Antibody (1B4-1A4) - Azide and BSA Free

Sandwich ELISA: Apc11 Antibody (1B4-1A4) [H00051529-M01] - Detection limit for recombinant GST tagged ANAPC11 is approximately 0.03ng/ml as a capture antibody.

Proximity Ligation Assay: Apc11 Antibody (1B4-1A4) [H00051529-M01] - Analysis of protein-protein interactions between CDC20 and ANAPC11. HeLa cells were stained with anti-CDC20 rabbit purified polyclonal 1:1200 and anti-ANAPC11 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

• Reactivity: Hu
• Applications: WB, ELISA, Func
• Clone: 1B4-1A4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Apc11 Antibody (1B4-1A4) - Azide and BSA Free Summary

• Immunogen: ANAPC11 (AAH00607, 1 a.a. ~ 54 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
• Specificity: ANAPC11 - APC11 anaphase promoting complex subunit 11 homolog (yeast)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ANAPC11
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Apc11 Antibody (1B4-1A4) - Azide and BSA Free

• anaphase promoting complex subunit 11 (yeast APC11 homolog)
• anaphase promoting complex subunit 11
• anaphase-promoting complex subunit 11
• APC11 anaphase promoting complex subunit 11 homolog
• APC11Hepatocellular carcinoma-associated RING finger protein
• Apc11p
• Cyclosome subunit 11
• HSPC214
• MGC882

Background

APC11 (anaphase-promoting complex subunit 11) is a member of the E3 enzyme family. This protein contains a RING-H2 domain and has a molecular weight of approximately 9.8 kD. The APC11 protein is distributed diffusely in the cytoplasm and is located in the nucleus with discrete accumulation in granular structures. The APC11 protein is a probable catalytic unit in the APC complex. The APC11 protein functions with other members of the APC complex as a multisubunit cell cycle ubiquitin ligase, and a regulator of sister chromatid separation by degrading securins. In addition, this protein functions in ubiquitin-dependent cyclin catabolism, metaphase/anaphase transition, and spindle elongation. The APC11 protein comprises one subunit of the anaphase promoting complex including APC1-8, and other probable complex proteins APC9-11, Cdc26, Mnd2, Swm1. The APC complex is inactivated by protein kinase A and is activated by CDC20 and Cdh1. In addition to the APC complex proteins, APC11 has been shown to interact with Ubc4. The Poly6116 antibody has been shown to be useful for Western blotting of the human and mouse APC11 protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Apc11 Antibody (H00051529-M01)(1)

Publication using H00051529-M01

• Drouet Y, Treilleux I, Viari A et al. Integrated analysis highlights APC11 protein expression as a likely new independent predictive marker for colorectal cancer. Sci Rep 2018-05-09 [PMID: 29743633]

Bioinformatics

• Gene Symbol: ANAPC11
• Entrez:
  • 51529(Human)
• Uniprot:
  • AAH00607(Human)