APBB2 Recombinant Protein Antigen

Images

 
There are currently no images for APBB2 Protein (NBP1-84700PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

APBB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human APBB2.

Source: E. coli

Amino Acid Sequence: SEKLEGKEPHPQDSSSCEILPSQPRRTKSFLNYYADLETSARELEQNRGNHHGTAEEKSQPVQGQASTIIGNGDLLLQKPNRPQSSPEDGQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
APBB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84700. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for APBB2 Recombinant Protein Antigen

  • amyloid beta (A4) precursor protein-binding, family B, member 2
  • amyloid beta A4 precursor protein-binding family B member 2
  • DKFZp434E033
  • FE65L1FE65LMGC35575
  • Fe65-like 1
  • Protein Fe65-like 1

Background

Proteolytic cleavage of the Amyloid protein precursor (APP) gives rise to the beta-Amyloid and Amyloid A4 proteins, which are present in human platelets. Amyloid deposition is associated with type II diabetes, Down's syndrome and a variety of neurological disorders, including Alzheimer's disease. The Amyloid precursor protein (APP) undergoes alternative splicing, resulting in several isoforms. Proteolytic cleavage of APP leads to the formation of the 4 kDa Amyloid ®/A4 protein. This protein is involved in the formation of neurofibrillary tangles and plaques that characterize the senile plaques of Alzheimer patients. APLP1 (Amyloid precursor-like protein 1) and APLP2 are structurally similar to APP. Human APLP2 is a membrane- bound sperm protein that contains a region highly homologous to the transmembrane-cytoplasmic domains of APP found in brain plaques of Alzheimer disease patients.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58360
Species: Hu, Mu, Rt
Applications: IP, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-01367
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF3129
Species: Hu
Applications: IHC, IP, Simple Western, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
MAB49451
Species: Hu
Applications: WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-47579
Species: Hu
Applications: IB, ICC/IF, IHC,  IHC-P, WB
NB100-64808
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
MAB931
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
NBP2-41182
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85482
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2658
Species: Hu
Applications: ICC, IHC, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-82820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB

Publications for APBB2 Protein (NBP1-84700PEP) (0)

There are no publications for APBB2 Protein (NBP1-84700PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APBB2 Protein (NBP1-84700PEP) (0)

There are no reviews for APBB2 Protein (NBP1-84700PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for APBB2 Protein (NBP1-84700PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APBB2 Products

Array NBP1-84700PEP

Research Areas for APBB2 Protein (NBP1-84700PEP)

Find related products by research area.

Blogs on APBB2

There are no specific blogs for APBB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our APBB2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol APBB2