AP3B1 Antibody

Images

 
Western Blot: AP3B1 Antibody [NBP1-68927] - Rat Liver lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AP3B1 Antibody Summary

Immunogen
Synthetic peptides corresponding to Ap3b1 (adaptor-related protein complex 3, beta 1 subunit) The peptide sequence was selected from the N terminal of Ap3b1. Peptide sequence MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM.
Specificity
This product is specific to AP3B1.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP3B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Ap3b1 and was validated on Western blot.
Theoretical MW
121 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AP3B1 Antibody

  • Adapter-related protein complex 3 subunit beta-1
  • Adaptor protein complex AP-3 subunit beta-1
  • adaptor-related protein complex 3, beta 1 subunit
  • ADTB3
  • ADTB3APE
  • AP-3 complex subunit beta-1
  • beta-3A-adaptin
  • beta3A-adaptin
  • Clathrin assembly protein complex 3 beta-1 large chain
  • HPS
  • HPS2AP-3 complex beta-3A subunit

Background

The function of Ap3b1 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07799
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005554-R02
Species: Hu
MAB5018
Species: Hu
Applications: WB, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11664
Species: Hu
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-68927
Species: Rt
Applications: WB

Publications for AP3B1 Antibody (NBP1-68927) (0)

There are no publications for AP3B1 Antibody (NBP1-68927).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP3B1 Antibody (NBP1-68927) (0)

There are no reviews for AP3B1 Antibody (NBP1-68927). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP3B1 Antibody (NBP1-68927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AP3B1 Products

Bioinformatics Tool for AP3B1 Antibody (NBP1-68927)

Discover related pathways, diseases and genes to AP3B1 Antibody (NBP1-68927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP3B1 Antibody (NBP1-68927)

Discover more about diseases related to AP3B1 Antibody (NBP1-68927).
 

Pathways for AP3B1 Antibody (NBP1-68927)

View related products by pathway.

PTMs for AP3B1 Antibody (NBP1-68927)

Learn more about PTMs related to AP3B1 Antibody (NBP1-68927).

Blogs on AP3B1

There are no specific blogs for AP3B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP3B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP3B1