Annexin V Antibody (1F4-1A5)

Images

 
Western Blot: Annexin V Antibody (1F4-1A5) [H00000308-M01] - ANXA5 monoclonal antibody (M01), clone 1F4-1A5. Analysis of ANXA5 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: Annexin V Antibody (1F4-1A5) [H00000308-M01] - Analysis of monoclonal antibody to ANXA5 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Annexin V Antibody (1F4-1A5) [H00000308-M01] - Analysis of monoclonal antibody to ANXA5 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: Annexin V Antibody (1F4-1A5) [H00000308-M01] - Analysis of ANXA5 expression in transfected 293T cell line by ANXA5 monoclonal antibody (M01), clone 1F4-1A5.Lane 1: ANXA5 transfected lysate(35.9 KDa).Lane ...read more
Immunoprecipitation: Annexin V Antibody (1F4-1A5) [H00000308-M01] - Analysis of ANXA5 transfected lysate using anti-ANXA5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ANXA5 MaxPab rabbit ...read more
ELISA: Annexin V Antibody (1F4-1A5) [H00000308-M01] - Detection limit for recombinant GST tagged ANXA5 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, IP
Clone
1F4-1A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Annexin V Antibody (1F4-1A5) Summary

Immunogen
ANXA5 (AAH01429, 1 a.a. - 320 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Specificity
ANXA5 - annexin A5
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ANXA5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00000308-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Annexin V Antibody (1F4-1A5)

  • Anchorin CII
  • annexin A5
  • Annexin V
  • annexin-5
  • ANX5
  • ANXA5
  • ANXV
  • Calphobindin I
  • Endonexin II
  • ENX2CBP-I
  • Lipocortin V
  • PAP-I
  • Placental anticoagulant protein 4
  • Placental anticoagulant protein I
  • PP4
  • Thromboplastin inhibitor
  • VAC-alpha
  • Vascular anticoagulant-alpha

Background

The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00000308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for Annexin V Antibody (H00000308-M01)(3)

Reviews for Annexin V Antibody (H00000308-M01) (0)

There are no reviews for Annexin V Antibody (H00000308-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Annexin V Antibody (H00000308-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Annexin V Products

Bioinformatics Tool for Annexin V Antibody (H00000308-M01)

Discover related pathways, diseases and genes to Annexin V Antibody (H00000308-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin V Antibody (H00000308-M01)

Discover more about diseases related to Annexin V Antibody (H00000308-M01).
 

Pathways for Annexin V Antibody (H00000308-M01)

View related products by pathway.

PTMs for Annexin V Antibody (H00000308-M01)

Learn more about PTMs related to Annexin V Antibody (H00000308-M01).
 

Research Areas for Annexin V Antibody (H00000308-M01)

Find related products by research area.

Blogs on Annexin V

There are no specific blogs for Annexin V, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Annexin V Antibody (1F4-1A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA5
Entrez
OMIM
Uniprot