Recombinant Human Annexin A1 Protein (H00000301-Q01)

Images

 
Recombinant Human Annexin A1 Protein [H00000301-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Annexin A1 Protein Summary

Description
Annexin A1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: FQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCGGN
Protein/Peptide Type
Partial Recombinant Protein
Gene
ANXA1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00000301-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Annexin A1 Protein

  • Annexin A1
  • annexin I (lipocortin I)
  • Annexin I
  • Annexin-1
  • ANX1
  • ANXA1
  • Calpactin II
  • calpactin-2
  • chromobindin-9
  • Lipocortin I
  • LPC1
  • LPC1annexin-1
  • p35
  • Phospholipase A2 inhibitory protein

Background

ANXA1 - annexin A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1916
Species: Hu
Applications: WB, IHC, ICC
AF7250
Species: Hu
Applications: IHC
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NBP1-83193
Species: Hu, Rt
Applications: WB, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP

Publications for Annexin A1 Partial Recombinant Protein (H00000301-Q01)(1)

Reviews for Annexin A1 Partial Recombinant Protein (H00000301-Q01) (0)

There are no reviews for Annexin A1 Partial Recombinant Protein (H00000301-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Annexin A1 Partial Recombinant Protein (H00000301-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human Annexin A1 Protein Products

Related Products by Gene

Bioinformatics Tool for Annexin A1 Partial Recombinant Protein (H00000301-Q01)

Discover related pathways, diseases and genes to Annexin A1 Partial Recombinant Protein (H00000301-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin A1 Partial Recombinant Protein (H00000301-Q01)

Discover more about diseases related to Annexin A1 Partial Recombinant Protein (H00000301-Q01).
 

Pathways for Annexin A1 Partial Recombinant Protein (H00000301-Q01)

View related products by pathway.

PTMs for Annexin A1 Partial Recombinant Protein (H00000301-Q01)

Learn more about PTMs related to Annexin A1 Partial Recombinant Protein (H00000301-Q01).
 

Research Areas for Annexin A1 Partial Recombinant Protein (H00000301-Q01)

Find related products by research area.

Blogs on Annexin A1

There are no specific blogs for Annexin A1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Annexin A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA1
Entrez

Customers Who Bought This Also Bought