Annexin A1 Antibody

Product Discontinued

Annexin A1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ANXA1 (annexin A1) The peptide sequence was selected from the N terminal of ANXA1. Peptide sequence WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANXA1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against ANXA1 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Annexin A1 Antibody

• Annexin A1
• annexin I (lipocortin I)
• Annexin I
• Annexin-1
• ANX1
• ANXA1
• Calpactin II
• calpactin-2
• chromobindin-9
• Lipocortin I
• LPC1
• LPC1annexin-1
• p35
• Phospholipase A2 inhibitory protein

Background

ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANXA1
• Uniprot:
  • Q5TZZ9(Human)