ANKRD49 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ANKRD49 Antibody [NBP1-83902] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ANKRD49 Antibody [NBP1-83902] - Staining of human colon shows strong nuclear, cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD49 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HLAAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD49
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ANKRD49 Protein (NBP1-83902PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD49 Antibody

  • ankyrin repeat domain 49
  • ankyrin repeat domain-containing protein 49
  • Fetal globin-inducing factor
  • FGIFFLJ20441
  • FLJ20189
  • GBIF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001836-M04
Species: Hu
Applications: WB, ELISA
AF4937
Species: Hu
Applications: WB, IHC
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-89772
Species: Hu
Applications: IHC, IHC-P
MAB7475
Species: Hu, Rt
Applications: WB
NBP2-00814
Species: Hu
Applications: WB, Flow, ICC/IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-80883
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
AF6394
Species: Hu
Applications: WB, IP
NBP1-82210
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00008462-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NBP1-85731
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83902
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ANKRD49 Antibody (NBP1-83902) (0)

There are no publications for ANKRD49 Antibody (NBP1-83902).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD49 Antibody (NBP1-83902) (0)

There are no reviews for ANKRD49 Antibody (NBP1-83902). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ANKRD49 Antibody (NBP1-83902) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD49 Products

Bioinformatics Tool for ANKRD49 Antibody (NBP1-83902)

Discover related pathways, diseases and genes to ANKRD49 Antibody (NBP1-83902). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD49 Antibody (NBP1-83902)

Discover more about diseases related to ANKRD49 Antibody (NBP1-83902).

Blogs on ANKRD49

There are no specific blogs for ANKRD49, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD49 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD49
Entrez
Uniprot