ANKFY1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ANKFY1 Antibody [NBP1-89084] Staining of human cell line U-2 OS shows positivity in vesicles.
Immunohistochemistry-Paraffin: ANKFY1 Antibody [NBP1-89084] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKFY1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYEC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKFY1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ANKFY1 Protein (NBP1-89084PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKFY1 Antibody

  • ANKHZN
  • ankyrin repeat and FYVE domain containing 1
  • ankyrin repeat and FYVE domain-containing protein 1
  • ankyrin repeat hooked to zinc finger motif
  • ankyrin repeats hooked to a zinc finger motif
  • DKFZp686M19106
  • KIAA1255
  • Rabankyrin-5
  • ZFYVE14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36754
Species: Hu
Applications: WB, IB, ICC/IF, IHC
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-56035
Species: Hu
Applications: WB, ICC/IF
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-93803
Species: Hu
Applications: IHC, IHC-P
NBP1-92310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24569
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, Simple Western, IHC-P
H00055198-B01P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-82588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-89029
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-47477
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7075
Species: Hu
Applications: WB
NBP1-89084
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ANKFY1 Antibody (NBP1-89084) (0)

There are no publications for ANKFY1 Antibody (NBP1-89084).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKFY1 Antibody (NBP1-89084) (0)

There are no reviews for ANKFY1 Antibody (NBP1-89084). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ANKFY1 Antibody (NBP1-89084) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKFY1 Products

Bioinformatics Tool for ANKFY1 Antibody (NBP1-89084)

Discover related pathways, diseases and genes to ANKFY1 Antibody (NBP1-89084). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKFY1 Antibody (NBP1-89084)

Discover more about diseases related to ANKFY1 Antibody (NBP1-89084).
 

Pathways for ANKFY1 Antibody (NBP1-89084)

View related products by pathway.

Blogs on ANKFY1

There are no specific blogs for ANKFY1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKFY1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKFY1
Entrez
Uniprot