AMPK gamma 1 Antibody [Alexa Fluor® 350]

Images

 

Product Details

Summary
Product Discontinued
View other related AMPK gamma 1 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-38409AF350
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

AMPK gamma 1 Antibody [Alexa Fluor® 350] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-331 of human AMPK gamma 1 (NP_002724.1).

Sequence:
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKAG1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for AMPK gamma 1 Antibody [Alexa Fluor® 350]

  • 5'-AMP-activated protein kinase subunit gamma-1
  • 5'-AMP-activated protein kinase, gamma-1 subunit
  • AMPK gamma 1
  • AMPK gamma-1 chain
  • AMPK gamma1
  • AMPK subunit gamma-1
  • AMPKG
  • AMPKG1
  • MGC8666
  • PRKAG1
  • protein kinase, AMP-activated, gamma 1 non-catalytic subunit

Background

The 5'-AMP-activated protein kinase (AMPK), a member of the SNF1 (sucrose non-fermentor) kinase family (1), is a heterotrimeric protein comprise of alpha (63 kDa), beta (30 kDa) and gamma (38 kDa) subunits. The alpah subunit is the catalytic subunit, while beta and gamma are non-catalytic subunits (although they have been found to interact with the active subunit in liver). AMPK regulates fatty acid and sterol synthesis by phosphorylation of acetyl-CoA as well as cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase (2). AMPK is activated by AMP and can be also regulated by treatment with purified protein phosphatase in vitro (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-61796
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-92286
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80992
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33518
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NBP1-89192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
DRP300
Species: Hu
Applications: ELISA
NBP2-33694
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00004831-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP2-24530
Species: Bv, Hu, Mu, Rt
Applications: Flow-IC, IHC,  IHC-P, WB
AF640
Species: Mu
Applications: IHC, WB

Publications for AMPK gamma 1 Antibody (NBP3-38409AF350) (0)

There are no publications for AMPK gamma 1 Antibody (NBP3-38409AF350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMPK gamma 1 Antibody (NBP3-38409AF350) (0)

There are no reviews for AMPK gamma 1 Antibody (NBP3-38409AF350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AMPK gamma 1 Antibody (NBP3-38409AF350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AMPK gamma 1 Products

Research Areas for AMPK gamma 1 Antibody (NBP3-38409AF350)

Find related products by research area.

Blogs on AMPK gamma 1

There are no specific blogs for AMPK gamma 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMPK gamma 1 Antibody [Alexa Fluor® 350] and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKAG1