Amnionless/AMN Recombinant Protein Antigen

Images

 
There are currently no images for Amnionless/AMN Protein (NBP1-91203PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Amnionless/AMN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AMN.

Source: E.coli

Amino Acid Sequence: VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISAL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AMN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-91203.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Amnionless/AMN Recombinant Protein Antigen

  • AMN
  • amnionless homolog (mouse)
  • Amnionless
  • PRO1028
  • protein amnionless
  • UNQ513/PRO1028
  • visceral endoderm-specific type 1 transmembrane protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3700
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-46476
Species: Hu
Applications: WB, IHC
NBP1-81610
Species: Hu
Applications: WB, IHC, IHC-P
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-57749
Species: Hu
Applications: WB, IHC
NB100-56176
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-86588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6380
Species: Mu
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP1-31329
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP1-89772
Species: Hu
Applications: IHC, IHC-P
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-26123
Species: Hu
Applications: WB, PEP-ELISA
NB100-791
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-92287
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Amnionless/AMN Protein (NBP1-91203PEP) (0)

There are no publications for Amnionless/AMN Protein (NBP1-91203PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Amnionless/AMN Protein (NBP1-91203PEP) (0)

There are no reviews for Amnionless/AMN Protein (NBP1-91203PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Amnionless/AMN Protein (NBP1-91203PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Amnionless/AMN Protein (NBP1-91203PEP)

Discover related pathways, diseases and genes to Amnionless/AMN Protein (NBP1-91203PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Amnionless/AMN Protein (NBP1-91203PEP)

Discover more about diseases related to Amnionless/AMN Protein (NBP1-91203PEP).
 

Pathways for Amnionless/AMN Protein (NBP1-91203PEP)

View related products by pathway.

PTMs for Amnionless/AMN Protein (NBP1-91203PEP)

Learn more about PTMs related to Amnionless/AMN Protein (NBP1-91203PEP).

Blogs on Amnionless/AMN

There are no specific blogs for Amnionless/AMN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Amnionless/AMN Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AMN