AMIGO Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

AMIGO Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AMIGO
  
  

  Source: E.coli

  Amino Acid Sequence: KPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: AMIGO1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25275It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AMIGO Recombinant Protein Antigen

• adhesion molecule with Ig-like domain 1
• ali2
• Alivin-2
• AMIGO
• AMIGO1
• AMIGO-1
• AMIGOamphoterin-induced protein 1
• amphoterin-induced gene and ORF
• KIAA1163

Background

Promotes growth and fasciculation of neurites from cultured hippocampal neurons. May be involved infasciculation as well as myelination of developing neural axons. May have a role in regeneration as well as neuralplasticity in the adult nervous system. May mediate homophilic as well as heterophilic cell-cell interaction andcontribute to signal transduction through its intracellular domain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AMIGO1