Recombinant Human ALS2CR2 Protein

Images

 
SDS-Page: ALS2CR2 Recombinant Protein [H00055437-P01]
Functional: Recombinant Human ALS2CR2 Protein [H00055437-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Func, PA, KA

Order Details

Recombinant Human ALS2CR2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-418 of Human STRADB full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSLLDCFCTSRTQVESLRPEKQSETSIHQYLVDEPTLSWSRPSTRASEVLCSTNVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTIKITNLENCNEERLKALQKAVILSHFFRHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPEGMSETLIRNILFGAVRGLNYLHQNGCIHRSIKASHILISGDGLVTLSGLSHLHSLVKHGQRHRAVYDFPQFSTSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
STRADB

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALS2CR2 Protein

  • ALS2CR2candidate 2
  • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein
  • CALS-21MGC102916
  • ILP-interacting protein
  • ILPIPSTRAD beta
  • Pseudokinase ALS2CR2
  • STE20-related kinase adaptor beta

Background

ALS2CR2( AAH08302, 1 a.a. - 419 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-15658
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15369
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-01317
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-24700
Species: Hu
Applications: WB
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56123
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP

Publications for ALS2CR2 Recombinant Protein (H00055437-P01) (0)

There are no publications for ALS2CR2 Recombinant Protein (H00055437-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALS2CR2 Recombinant Protein (H00055437-P01) (0)

There are no reviews for ALS2CR2 Recombinant Protein (H00055437-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALS2CR2 Recombinant Protein (H00055437-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALS2CR2 Products

Bioinformatics Tool for ALS2CR2 Recombinant Protein (H00055437-P01)

Discover related pathways, diseases and genes to ALS2CR2 Recombinant Protein (H00055437-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALS2CR2 Recombinant Protein (H00055437-P01)

Discover more about diseases related to ALS2CR2 Recombinant Protein (H00055437-P01).

Research Areas for ALS2CR2 Recombinant Protein (H00055437-P01)

Find related products by research area.

Blogs on ALS2CR2

There are no specific blogs for ALS2CR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ALS2CR2 Antibody
NBP1-90183
Caspase-9 Antibody
NB100-56118

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALS2CR2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STRADB