Recombinant Human ALS2CR2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ALS2CR2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 319-418 of Human ALS2CR2

Source: Wheat Germ

Amino Acid Sequence: SSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
STRADB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALS2CR2 Protein

  • ALS2CR2candidate 2
  • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein
  • CALS-21MGC102916
  • ILP-interacting protein
  • ILPIPSTRAD beta
  • Pseudokinase ALS2CR2
  • STE20-related kinase adaptor beta

Background

ALS2CR2 - amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-15658
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-01317
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-24700
Species: Hu
Applications: WB
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC, KO
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-239
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NB100-56141
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56123
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP

Publications for ALS2CR2 Partial Recombinant Protein (H00055437-Q01) (0)

There are no publications for ALS2CR2 Partial Recombinant Protein (H00055437-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALS2CR2 Partial Recombinant Protein (H00055437-Q01) (0)

There are no reviews for ALS2CR2 Partial Recombinant Protein (H00055437-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALS2CR2 Partial Recombinant Protein (H00055437-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ALS2CR2 Partial Recombinant Protein (H00055437-Q01)

Discover related pathways, diseases and genes to ALS2CR2 Partial Recombinant Protein (H00055437-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALS2CR2 Partial Recombinant Protein (H00055437-Q01)

Discover more about diseases related to ALS2CR2 Partial Recombinant Protein (H00055437-Q01).

Research Areas for ALS2CR2 Partial Recombinant Protein (H00055437-Q01)

Find related products by research area.

Blogs on ALS2CR2

There are no specific blogs for ALS2CR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ALS2CR2 Antibody
NBP1-90183
Caspase-9 Antibody
NB100-56118

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALS2CR2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STRADB