Recombinant Human alpha-Sarcoglycan Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human alpha-Sarcoglycan Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 26-133 of Human SGCA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SGCA
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human alpha-Sarcoglycan Protein

  • 50-DAG
  • Adhalin
  • ADL
  • alphaSarcoglycan
  • alpha-Sarcoglycan
  • DAG2
  • DMDA2
  • DMDA250kD DAG
  • Dystroglycan-2
  • LGMD2D
  • LGMD2Dalpha (50kD dystrophin-associated glycoprotein)
  • sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein)
  • SCARMD1
  • SGCA

Background

The dystrophin-glycoprotein complex (DGC) comprises a group of proteins that are critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Components of the DGC include dystrophin (MIM 300377), which is deficient in Duchenne muscular dystrophy (DMD; MIM 310200); syntrophins (e.g., MIM 600026); dystroglycans (MIM 128239); and sarcoglycans, such as adhalin, a 50-kD transmembrane protein (Roberds et al., 1993 [PubMed 8226900]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-62539
Species: Hu
Applications: WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for alpha-Sarcoglycan Partial Recombinant Protein (H00006442-Q01) (0)

There are no publications for alpha-Sarcoglycan Partial Recombinant Protein (H00006442-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-Sarcoglycan Partial Recombinant Protein (H00006442-Q01) (0)

There are no reviews for alpha-Sarcoglycan Partial Recombinant Protein (H00006442-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha-Sarcoglycan Partial Recombinant Protein (H00006442-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alpha-Sarcoglycan Products

Bioinformatics Tool for alpha-Sarcoglycan Partial Recombinant Protein (H00006442-Q01)

Discover related pathways, diseases and genes to alpha-Sarcoglycan Partial Recombinant Protein (H00006442-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha-Sarcoglycan Partial Recombinant Protein (H00006442-Q01)

Discover more about diseases related to alpha-Sarcoglycan Partial Recombinant Protein (H00006442-Q01).
 

Pathways for alpha-Sarcoglycan Partial Recombinant Protein (H00006442-Q01)

View related products by pathway.

PTMs for alpha-Sarcoglycan Partial Recombinant Protein (H00006442-Q01)

Learn more about PTMs related to alpha-Sarcoglycan Partial Recombinant Protein (H00006442-Q01).

Blogs on alpha-Sarcoglycan

There are no specific blogs for alpha-Sarcoglycan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD20 Antibody (AISB12)
NBP1-43435-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human alpha-Sarcoglycan Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SGCA
Entrez