Alpha Dystroglycan Antibody (2A3)

Images

 
Sandwich ELISA: Alpha Dystroglycan Antibody (2A3) [H00001605-M01] - Detection limit for recombinant GST tagged DAG1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Alpha Dystroglycan Antibody (2A3) Summary

Immunogen
DAG1 (AAH12740, 31 a.a. - 140 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGA
Specificity
DAG1 - dystroglycan 1 (dystrophin-associated glycoprotein 1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DAG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00001605-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Alpha Dystroglycan Antibody (2A3)

  • A3a
  • AGRNR
  • DAG156DAG
  • dystroglycan 1 (dystrophin-associated glycoprotein 1)
  • dystroglycan
  • Dystrophin-associated glycoprotein 1

Background

Dystroglycan is a laminin binding component of the dystrophin-glycoprotein complex which provides a linkage between the subsarcolemmal cytoskeleton and the extracellular matrix. Dystroglycan 1 is a candidate gene for the site of the mutation in autosomal recessive muscular dystrophies. The dramatic reduction of dystroglycan 1 in Duchenne muscular dystrophy leads to a loss of linkage between the sarcolemma and extracellular matrix, rendering muscle fibers more susceptible to necrosis. Dystroglycan also functions as dual receptor for agrin and laminin-2 in the Schwann cell membrane. The muscle and nonmuscle isoforms of dystroglycan differ by carbohydrate moieties but not protein sequence.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
AF2364
Species: Hu
Applications: WB, IHC
NBP2-07799
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005554-R02
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33383
Species: Hu
Applications: WB, ICC/IF
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
H00001605-M01
Species: Hu
Applications: WB, ELISA

Publications for Alpha Dystroglycan Antibody (H00001605-M01)(1)

Reviews for Alpha Dystroglycan Antibody (H00001605-M01) (0)

There are no reviews for Alpha Dystroglycan Antibody (H00001605-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Alpha Dystroglycan Antibody (H00001605-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Alpha Dystroglycan Products

Bioinformatics Tool for Alpha Dystroglycan Antibody (H00001605-M01)

Discover related pathways, diseases and genes to Alpha Dystroglycan Antibody (H00001605-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alpha Dystroglycan Antibody (H00001605-M01)

Discover more about diseases related to Alpha Dystroglycan Antibody (H00001605-M01).
 

Pathways for Alpha Dystroglycan Antibody (H00001605-M01)

View related products by pathway.

PTMs for Alpha Dystroglycan Antibody (H00001605-M01)

Learn more about PTMs related to Alpha Dystroglycan Antibody (H00001605-M01).
 

Research Areas for Alpha Dystroglycan Antibody (H00001605-M01)

Find related products by research area.

Blogs on Alpha Dystroglycan

There are no specific blogs for Alpha Dystroglycan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Alpha Dystroglycan Antibody (2A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol DAG1
Entrez
OMIM
Uniprot