Recombinant Human alpha-Defensin 1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human alpha-Defensin 1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-94 of Human DEFA1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKSMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
DEFA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.08 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human alpha-Defensin 1 GST (N-Term) Protein

  • alpha 2
  • alphaDefensin 1
  • alpha-Defensin 1
  • DEF1
  • DEF1DEFA1B
  • DEFA1
  • DEFA2
  • defensin, alpha 1, myeloid-related sequence
  • defensin, alpha 1HP-1
  • HNP-1
  • HNP-1HP1
  • HP1
  • MRS
  • MRSMGC138393
  • myeloid-related sequence
  • neutrophil defensin 1

Background

DEFA1( AAH27917, 1 a.a. - 95 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
NBP2-98675
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, IP, WB
NB100-1598
Species: Hu, Mu
Applications: Flow, ICC/IF, WB
DHAPG0
Species: Hu
Applications: ELISA
H00001668-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB300-917
Species: Hu, Mu
Applications: IF, IHC, IHC-P
AF4066
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP1-90309
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-21367
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF1408
Species: Hu, Rt
Applications: IHC, IP, KO, Simple Western, WB
H00001667-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for alpha-Defensin 1 Recombinant Protein (H00001667-P01) (0)

There are no publications for alpha-Defensin 1 Recombinant Protein (H00001667-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-Defensin 1 Recombinant Protein (H00001667-P01) (0)

There are no reviews for alpha-Defensin 1 Recombinant Protein (H00001667-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha-Defensin 1 Recombinant Protein (H00001667-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alpha-Defensin 1 Products

Bioinformatics Tool for alpha-Defensin 1 Recombinant Protein (H00001667-P01)

Discover related pathways, diseases and genes to alpha-Defensin 1 Recombinant Protein (H00001667-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha-Defensin 1 Recombinant Protein (H00001667-P01)

Discover more about diseases related to alpha-Defensin 1 Recombinant Protein (H00001667-P01).
 

Pathways for alpha-Defensin 1 Recombinant Protein (H00001667-P01)

View related products by pathway.

PTMs for alpha-Defensin 1 Recombinant Protein (H00001667-P01)

Learn more about PTMs related to alpha-Defensin 1 Recombinant Protein (H00001667-P01).
 

Research Areas for alpha-Defensin 1 Recombinant Protein (H00001667-P01)

Find related products by research area.

Blogs on alpha-Defensin 1.

Toll-like receptors in the intestinal epithelial cells
By Jamshed Arslan, Pharm. D., PhD. Toll-like receptors (TLRs) are microbe-sensing proteins that act as first responders to danger signals. TLRs help the intestinal epithelial cells (IECs) recognize commensal bacteria ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human alpha-Defensin 1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DEFA1