Recombinant Human alpha Adaptin Protein

Images

 
SDS-Page: Recombinant Human alpha Adaptin Protein [H00000160-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human alpha Adaptin Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 824-923 of Human alpha Adaptin

Source: Wheat Germ

Amino Acid Sequence: QVLNIECLRDFLTPPLLSVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLGFGSALLDNVDPNP

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
AP2A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human alpha Adaptin Protein

  • 100 kDa coated vesicle protein A
  • Adapter-related protein complex 2 alpha-1 subunit
  • Adaptor protein complex AP-2 subunit alpha-1
  • adaptor-related protein complex 2, alpha 1 subunit
  • ADTAAAP2-ALPHA
  • Alpha1-adaptin
  • Alpha-adaptin A
  • AP-2 complex subunit alpha-1
  • CLAPA1adaptin, alpha A
  • Clathrin assembly protein complex 2 alpha-A large chain
  • clathrin-associated/assembly/adaptor protein, large, alpha 1
  • Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit

Background

AP2A1 - adaptor-related protein complex 2, alpha 1 subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92539
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-38290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-02902
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF2800
Species: Mu
Applications: WB, IHC, Block
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-55178
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP1-72296
Species: Hu
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92649
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB400-146
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000160-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for alpha Adaptin Partial Recombinant Protein (H00000160-Q01) (0)

There are no publications for alpha Adaptin Partial Recombinant Protein (H00000160-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha Adaptin Partial Recombinant Protein (H00000160-Q01) (0)

There are no reviews for alpha Adaptin Partial Recombinant Protein (H00000160-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha Adaptin Partial Recombinant Protein (H00000160-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for alpha Adaptin Partial Recombinant Protein (H00000160-Q01)

Discover related pathways, diseases and genes to alpha Adaptin Partial Recombinant Protein (H00000160-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha Adaptin Partial Recombinant Protein (H00000160-Q01)

Discover more about diseases related to alpha Adaptin Partial Recombinant Protein (H00000160-Q01).
 

Pathways for alpha Adaptin Partial Recombinant Protein (H00000160-Q01)

View related products by pathway.

Blogs on alpha Adaptin

There are no specific blogs for alpha Adaptin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Glut4 Antibody
NBP1-49533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human alpha Adaptin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AP2A1