Recombinant Human alpha 2-Macroglobulin-like 1/A2ML1 Protein

Order Details


    • Catalog Number
      H00144568-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human alpha 2-Macroglobulin-like 1/A2ML1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 158 of Human A2ML1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
A2ML1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 100 mM NaCl, pH 8.0, 5 mM DTT, 4 mM reduced glutathione, 20% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human alpha 2-Macroglobulin-like 1/A2ML1 Protein

  • A2ML1
  • alpha 2Macroglobulin like 1
  • alpha 2-Macroglobulin-like 1
  • alpha-2-macroglobulin-like 1
  • alpha-2-macroglobulin-like protein 1
  • C3 and PZP-like, alpha-2-macroglobulin domain containing 9
  • CPAMD9

Background

The alpha-macroglobulin (AM) superfamily of proteins contains both complement components and protease inhibitors, including A2M (MIM 103950) and A2ML1. AM proteins display a unique trap mechanism of inhibition, by which the AM inhibitor undergoes a major conformational change upon its cleavage by a protease, thus trapping the protease and blocking it from subsequent substrate binding (Galliano et al., 2006 [PubMed 16298998]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
AF2008
Species: Hu
Applications: WB, IHC, IP
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
AF1938
Species: Hu
Applications: WB, Simple Western, IP, ICC
AF1408
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IP
H00010438-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
MAB8280
Species: Hu
Applications: WB

Publications for alpha 2-Macroglobulin-like 1/A2ML1 Recombinant Protein (H00144568-P01) (0)

There are no publications for alpha 2-Macroglobulin-like 1/A2ML1 Recombinant Protein (H00144568-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha 2-Macroglobulin-like 1/A2ML1 Recombinant Protein (H00144568-P01) (0)

There are no reviews for alpha 2-Macroglobulin-like 1/A2ML1 Recombinant Protein (H00144568-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha 2-Macroglobulin-like 1/A2ML1 Recombinant Protein (H00144568-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alpha 2-Macroglobulin-like 1/A2ML1 Products

Bioinformatics Tool for alpha 2-Macroglobulin-like 1/A2ML1 Recombinant Protein (H00144568-P01)

Discover related pathways, diseases and genes to alpha 2-Macroglobulin-like 1/A2ML1 Recombinant Protein (H00144568-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha 2-Macroglobulin-like 1/A2ML1 Recombinant Protein (H00144568-P01)

Discover more about diseases related to alpha 2-Macroglobulin-like 1/A2ML1 Recombinant Protein (H00144568-P01).
 

Pathways for alpha 2-Macroglobulin-like 1/A2ML1 Recombinant Protein (H00144568-P01)

View related products by pathway.

Blogs on alpha 2-Macroglobulin-like 1/A2ML1

There are no specific blogs for alpha 2-Macroglobulin-like 1/A2ML1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human alpha 2-Macroglobulin-like 1/A2ML1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol A2ML1
Entrez