alpha-1D Adrenergic R/ADRA1D Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: PFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADRA1D |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for alpha-1D Adrenergic R/ADRA1D Antibody - BSA Free
Background
The alpha 1d-adrenoceptor is an Adrenergic Receptor that causes the contraction of smooth muscle and increases intracellular calcium. Expression of the alpha 1d-adrenoceptor has been reported primarily in smooth muscle of arterioles, eye, gut, skin, vein, as well as in other cell types (e.g. salivary gland). Adrenoceptors are also expressed in hippocampus, cerebral cortex, and brainstem. Caution: The name ADRA1A has been used to describe both the alpha 1d adrenoceptor (human chromosome 20) and the alpha 1c adrenoceptor (human chromosome 8), and the alpha 1c adrenoceptor is also known as alpha 1a adrenoceptor.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Ha, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC
Publications for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229) (0)
There are no publications for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229) (0)
There are no reviews for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional alpha-1D Adrenergic R/ADRA1D Products
Research Areas for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229)
Find related products by research area.
|
Blogs on alpha-1D Adrenergic R/ADRA1D