alpha-1D Adrenergic R/ADRA1D Antibody


Immunohistochemistry: alpha-1D Adrenergic R/ADRA1D Antibody [NBP1-90229] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

alpha-1D Adrenergic R/ADRA1D Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRE
Specificity of human alpha-1D Adrenergic R/ADRA1D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
alpha-1D Adrenergic R/ADRA1D Protein (NBP1-90229PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for alpha-1D Adrenergic R/ADRA1D Antibody

  • a-1D AdrenergicR
  • ADRA1
  • ADRA1D
  • ADRA1R
  • adrenergic, alpha -1D-, receptor
  • adrenergic, alpha-1A-, receptor
  • adrenergic, alpha-1D-, receptor
  • ALPHA1
  • Alpha-1A adrenergic receptor
  • alpha-1D Adrenergic R
  • alpha-1D adrenergic receptor
  • alpha1D AdrenergicR
  • Alpha-1D adrenoceptor
  • Alpha-1D adrenoreceptor
  • alpha-1D-adrenergic receptor
  • Alpha-adrenergic receptor 1a
  • DAR
  • dJ779E11.2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229) (0)

There are no publications for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229) (0)

There are no reviews for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional alpha-1D Adrenergic R/ADRA1D Products

Bioinformatics Tool for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229)

Discover related pathways, diseases and genes to alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229)

Discover more about diseases related to alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229).

Pathways for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229)

View related products by pathway.

PTMs for alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229)

Learn more about PTMs related to alpha-1D Adrenergic R/ADRA1D Antibody (NBP1-90229).

Blogs on alpha-1D Adrenergic R/ADRA1D

There are no specific blogs for alpha-1D Adrenergic R/ADRA1D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our alpha-1D Adrenergic R/ADRA1D Antibody and receive a gift card or discount.


Gene Symbol ADRA1D