alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: alpha-1B Adrenergic R/ADRA1B Antibody [NBP2-57288] - Staining of human cell line U-251 MG shows localization to plasma membrane.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVG
• Predicted Species: Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADRA1B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  alpha-1B Adrenergic R/ADRA1B Recombinant Protein Antigen (NBP2-57288PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free

• a-1B AdrenergicR
• ADRA1
• ADRA1B
• adrenergic, alpha-1B-, receptor
• alpha-1B Adrenergic R
• alpha-1B adrenergic receptor
• alpha1B AdrenergicR
• Alpha-1B adrenoceptor
• Alpha-1B adrenoreceptor
• alpha-1B-adrenergic receptor
• ALPHA1BAR

Background

The alpha-1b adrenoceptor is an Adrenergic Receptor that causes contraction of smooth muscle cells and thereby controls vascular tone, blood pressure, and accelerates the development of atherosclerosis. Decreased alpha-1b adrenoceptor is associated with benign prostatic hyperplasia (BPH). This adrenergic receptor also acts as a proto-oncogene when transfected into cell lines where constitutive activation of the receptor induces neoplastic transformation. The alpha-1b adrenoceptor has been documented in adrenal, aorta, blood, various brain regions, eye, heart, kidney, liver, prostate, spinal cord, and spleen. ESTs have been isolated from kidney (normal and cancer) and lung carcinoma libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADRA1B