alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free (NBP2-57288) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVG |
| Predicted Species |
Mouse (96%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADRA1B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for alpha-1B Adrenergic R/ADRA1B Antibody - BSA Free
Background
The alpha-1b adrenoceptor is an Adrenergic Receptor that causes contraction of smooth muscle cells and thereby controls vascular tone, blood pressure, and accelerates the development of atherosclerosis. Decreased alpha-1b adrenoceptor is associated with benign prostatic hyperplasia (BPH). This adrenergic receptor also acts as a proto-oncogene when transfected into cell lines where constitutive activation of the receptor induces neoplastic transformation. The alpha-1b adrenoceptor has been documented in adrenal, aorta, blood, various brain regions, eye, heart, kidney, liver, prostate, spinal cord, and spleen. ESTs have been isolated from kidney (normal and cancer) and lung carcinoma libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bt, Bv, Ca, Eq, Hu, Pm, Po, Pm, Rb, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Publications for alpha-1B Adrenergic R/ADRA1B Antibody (NBP2-57288) (0)
There are no publications for alpha-1B Adrenergic R/ADRA1B Antibody (NBP2-57288).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for alpha-1B Adrenergic R/ADRA1B Antibody (NBP2-57288) (0)
There are no reviews for alpha-1B Adrenergic R/ADRA1B Antibody (NBP2-57288).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for alpha-1B Adrenergic R/ADRA1B Antibody (NBP2-57288) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional alpha-1B Adrenergic R/ADRA1B Products
Research Areas for alpha-1B Adrenergic R/ADRA1B Antibody (NBP2-57288)
Find related products by research area.
|
Blogs on alpha-1B Adrenergic R/ADRA1B