Recombinant Human ALOXE3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ALOXE3 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 97 of Human ALOXE3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAVYRLCVTTGPYLRAGTLDNISVTLVGTCGESPKQRLDRMGRDFAPGSVQKYKVRCTAELGELLLLRVHKERYAFFRKDSWYCSRICVTEPDGSVS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ALOXE3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALOXE3 Protein

  • arachidonate lipoxygenase 3
  • EC 1.13.11.-
  • E-LOX
  • eLOX3
  • e-LOX-3
  • epidermal lipoxygenase
  • epidermis-type lipoxygenase 3
  • MGC119694
  • MGC119695
  • MGC119696

Background

ALOXE3 - arachidonate lipoxygenase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29941
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000247-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01740
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-90274
Species: Hu
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for ALOXE3 Partial Recombinant Protein (H00059344-Q01) (0)

There are no publications for ALOXE3 Partial Recombinant Protein (H00059344-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALOXE3 Partial Recombinant Protein (H00059344-Q01) (0)

There are no reviews for ALOXE3 Partial Recombinant Protein (H00059344-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALOXE3 Partial Recombinant Protein (H00059344-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALOXE3 Products

Bioinformatics Tool for ALOXE3 Partial Recombinant Protein (H00059344-Q01)

Discover related pathways, diseases and genes to ALOXE3 Partial Recombinant Protein (H00059344-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALOXE3 Partial Recombinant Protein (H00059344-Q01)

Discover more about diseases related to ALOXE3 Partial Recombinant Protein (H00059344-Q01).
 

Pathways for ALOXE3 Partial Recombinant Protein (H00059344-Q01)

View related products by pathway.

Research Areas for ALOXE3 Partial Recombinant Protein (H00059344-Q01)

Find related products by research area.

Blogs on ALOXE3

There are no specific blogs for ALOXE3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LOX Antibody
NB100-2527
ALOXE3 Antibody
NBP1-32533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALOXE3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALOXE3