Alix Recombinant Protein Antigen

Images

 
There are currently no images for Alix Protein (NBP1-90201PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Alix Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDCD6IP.

Source: E.coli

Amino Acid Sequence: VPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDND

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDCD6IP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90201.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Alix Recombinant Protein Antigen

  • AIP1DRIP4
  • ALG-2 interacting protein 1
  • ALG-2 interacting protein X
  • ALG-2-interacting protein 1
  • alinx
  • Alix
  • apoptosis-linked gene 2-interacting protein X
  • dopamine receptor interacting protein 4
  • HP95
  • KIAA1375
  • MGC17003
  • PDCD6-interacting protein
  • programmed cell death 6 interacting protein
  • programmed cell death 6-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-65248
Species: Hu
NBP1-91782
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54618
Species: Hu
Applications: WB, IHC
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-32665
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-84158
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90201PEP
Species: Hu
Applications: AC

Publications for Alix Protein (NBP1-90201PEP) (0)

There are no publications for Alix Protein (NBP1-90201PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alix Protein (NBP1-90201PEP) (0)

There are no reviews for Alix Protein (NBP1-90201PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Alix Protein (NBP1-90201PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Alix Protein (NBP1-90201PEP)

Discover related pathways, diseases and genes to Alix Protein (NBP1-90201PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alix Protein (NBP1-90201PEP)

Discover more about diseases related to Alix Protein (NBP1-90201PEP).
 

Pathways for Alix Protein (NBP1-90201PEP)

View related products by pathway.

PTMs for Alix Protein (NBP1-90201PEP)

Learn more about PTMs related to Alix Protein (NBP1-90201PEP).
 

Research Areas for Alix Protein (NBP1-90201PEP)

Find related products by research area.

Blogs on Alix.

Tools for Isolation, Quantification and Analysis of Exosomes
Exosomes are spherical to cup-shaped bilayered membrane enclosed nanosize vesicles (30-100 nm) which have the ability to shuttle active cargoes between cells. Johnstone et al. 1987 pioneered in documenting the generation of exosomes in differentiat...  Read full blog post.

Customers Who Bought This Also Bought

Alix Antibody
NBP1-90201

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Alix Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDCD6IP