ALG5 Antibody

Images

 
Western Blot: ALG5 Antibody [NBP2-86978] - WB Suggested Anti-ALG5 Antibody. Titration: 1.0 ug/ml. Positive Control: COLO205 Whole CellALG5 is supported by BioGPS gene expression data to be expressed in COLO205

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALG5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of ALG5. Peptide sequence: ALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVIT The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (100%), Canine (100%), Equine (100%), Rabbit (93%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ALG5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALG5 Antibody

  • Alg5, S. cerevisiae, homolog of
  • asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphatebeta-glucosyltransferase)
  • asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphatebeta-glucosyltransferase)
  • asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferasehomolog (S. cerevisiae)
  • Asparagine-linked glycosylation protein 5 homolog
  • bA421P11.2
  • dolichyl phosphate glucosyltransferase
  • dolichyl-phosphate beta-glucosyltransferase
  • dolP-glucosyltransferase
  • EC 2.4.1
  • EC 2.4.1.117
  • RP11-421P11.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-62494
Species: Hu
Applications: WB
NBP1-05034
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-47550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14281
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91577
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1049
Species: Hu
Applications: WB, IHC
NBP1-80835
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94061
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84579
Species: Hu
Applications: IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP2-01734
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-86978
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for ALG5 Antibody (NBP2-86978) (0)

There are no publications for ALG5 Antibody (NBP2-86978).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG5 Antibody (NBP2-86978) (0)

There are no reviews for ALG5 Antibody (NBP2-86978). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALG5 Antibody (NBP2-86978) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ALG5 Products

Bioinformatics Tool for ALG5 Antibody (NBP2-86978)

Discover related pathways, diseases and genes to ALG5 Antibody (NBP2-86978). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG5 Antibody (NBP2-86978)

Discover more about diseases related to ALG5 Antibody (NBP2-86978).
 

Pathways for ALG5 Antibody (NBP2-86978)

View related products by pathway.

PTMs for ALG5 Antibody (NBP2-86978)

Learn more about PTMs related to ALG5 Antibody (NBP2-86978).

Blogs on ALG5

There are no specific blogs for ALG5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG5