ALG5 Antibody - BSA Free

Western Blot: ALG5 Antibody [NBP2-86978] - WB Suggested Anti-ALG5 Antibody. Titration: 1.0 ug/ml. Positive Control: COLO205 Whole CellALG5 is supported by BioGPS gene expression data to be expressed in COLO205

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ALG5 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of ALG5. Peptide sequence: ALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVIT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALG5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ALG5 Antibody - BSA Free

• Alg5, S. cerevisiae, homolog of
• asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphatebeta-glucosyltransferase)
• asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphatebeta-glucosyltransferase)
• asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferasehomolog (S. cerevisiae)
• Asparagine-linked glycosylation protein 5 homolog
• bA421P11.2
• dolichyl phosphate glucosyltransferase
• dolichyl-phosphate beta-glucosyltransferase
• dolP-glucosyltransferase
• EC 2.4.1
• EC 2.4.1.117
• RP11-421P11.2

Background

ALG5, also known as Dolichyl-phosphate beta-glucosyltransferase, has a 37 kDa and a 34 kDa isoform, and is involved in the process of substrate recognition. Disease research is currently being conducted on ALG5 and its relation to the congenital disorder of glycosylation. The protein has been linked to several protein metabolism, biosynthesis, and modification pathways, where it interacts with ACER3, DDOST, PIGK, RPN1, and ALG12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALG5