Recombinant Human ALG2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ALG2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 317 - 416 of Human ALG2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV

Protein/Peptide Type
Partial Recombinant Protein
Gene
ALG2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Tris, pH 8.0, 20% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALG2 Protein

  • alpha-1,3-mannosyltransferase ALG2
  • alpha-1,3-mannosyltransferase)
  • asparagine-linked glycosylation 2 homolog (S. cerevisiae
  • asparagine-linked glycosylation 2 homolog (yeast
  • asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S.cerevisiae)
  • Asparagine-linked glycosylation protein 2 homolog
  • CDGIi
  • EC 2.4.1
  • EC 2.4.1.-
  • FLJ14511
  • GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase
  • hALPG2
  • homolog of yeast ALG2
  • NET38

Background

ALG2 - asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32539
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-05034
Species: Hu
Applications: WB, PEP-ELISA
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-62494
Species: Hu
Applications: WB
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91577
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76869
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-16215
Species: Hu
Applications: WB, ChIP, IP
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91658
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
H00085365-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ALG2 Partial Recombinant Protein (H00085365-Q01) (0)

There are no publications for ALG2 Partial Recombinant Protein (H00085365-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG2 Partial Recombinant Protein (H00085365-Q01) (0)

There are no reviews for ALG2 Partial Recombinant Protein (H00085365-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALG2 Partial Recombinant Protein (H00085365-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALG2 Products

Bioinformatics Tool for ALG2 Partial Recombinant Protein (H00085365-Q01)

Discover related pathways, diseases and genes to ALG2 Partial Recombinant Protein (H00085365-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG2 Partial Recombinant Protein (H00085365-Q01)

Discover more about diseases related to ALG2 Partial Recombinant Protein (H00085365-Q01).
 

Pathways for ALG2 Partial Recombinant Protein (H00085365-Q01)

View related products by pathway.

PTMs for ALG2 Partial Recombinant Protein (H00085365-Q01)

Learn more about PTMs related to ALG2 Partial Recombinant Protein (H00085365-Q01).

Blogs on ALG2

There are no specific blogs for ALG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ALG2 Antibody
NBP1-85715

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALG2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG2