ALG10B Antibody

Images

 
Western Blot: ALG10B Antibody [NBP3-09561] - Western blot analysis of ALG10B in MCF7 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALG10B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ALG10B (NP_001013642). Peptide sequence GFCGFMFRQTNIIWAVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFA
Clonality
Polyclonal
Host
Rabbit
Gene
ALG10B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for ALG10B Antibody

  • ALG10
  • KCR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-62494
Species: Hu
Applications: WB
NBP1-05034
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-76939
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-84125
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-75552
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NBP2-42202
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-47550
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-76961
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-12895
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, MiAr, WB
NB110-61010
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, RIA, WB
NBP1-86057
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-33863
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP3-03748
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
NBP2-46439
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-84935
Species: Hu
Applications: IHC, IHC-P
NBP1-88767
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ALG10B Antibody (NBP3-09561) (0)

There are no publications for ALG10B Antibody (NBP3-09561).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG10B Antibody (NBP3-09561) (0)

There are no reviews for ALG10B Antibody (NBP3-09561). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALG10B Antibody (NBP3-09561) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALG10B Products

Array NBP3-09561

Bioinformatics Tool for ALG10B Antibody (NBP3-09561)

Discover related pathways, diseases and genes to ALG10B Antibody (NBP3-09561). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG10B Antibody (NBP3-09561)

Discover more about diseases related to ALG10B Antibody (NBP3-09561).
 

Pathways for ALG10B Antibody (NBP3-09561)

View related products by pathway.

PTMs for ALG10B Antibody (NBP3-09561)

Learn more about PTMs related to ALG10B Antibody (NBP3-09561).

Blogs on ALG10B

There are no specific blogs for ALG10B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG10B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG10B