Aldo-keto Reductase 1C1/AKR1C1 Synthetic Peptide Summary
| Description |
A blocking peptide from human Aldo-keto Reductase 1C1/AKR1C1. Source: Synthetic Amino Acid Sequence: LERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATW |
| Source |
Synthetic |
| Protein/Peptide Type |
Synthetic Peptide |
| Isotype |
IgG |
| Gene |
AKR1C1 |
| Purity |
N/A |
Applications/Dilutions
| Dilutions |
- Antibody Competition
- Western Blot
|
| Application Notes |
This is a synthetic peptide designed for use in combination with Aldo-keto Reductase 1C1/AKR1C1 Antibody (Catalog #: NBP1-68878). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochemistry under proper experimental settings. There is no guarantee for its use in other applications. |
| Theoretical MW |
36 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20 degrees C. Avoid freeze/thaw cycles. |
| Buffer |
Lyophilized |
| Preservative |
No Preservative |
| Concentration |
LYOPH |
| Purity |
N/A |
| Reconstitution Instructions |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Alternate Names for Aldo-keto Reductase 1C1/AKR1C1 Synthetic Peptide
Background
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC
Publications for Aldo-keto Reductase 1C1/AKR1C1 Protein (NBP1-68878PEP) (0)
There are no publications for Aldo-keto Reductase 1C1/AKR1C1 Protein (NBP1-68878PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Aldo-keto Reductase 1C1/AKR1C1 Protein (NBP1-68878PEP) (0)
There are no reviews for Aldo-keto Reductase 1C1/AKR1C1 Protein (NBP1-68878PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Aldo-keto Reductase 1C1/AKR1C1 Protein (NBP1-68878PEP) (0)
Additional Aldo-keto Reductase 1C1/AKR1C1 Products
Blogs on Aldo-keto Reductase 1C1/AKR1C1