Aldo-keto Reductase 1C1/AKR1C1 Antibody

Western Blot: Aldo-keto Reductase 1C1/AKR1C1 Antibody [H00001645-B01P] - Analysis of AKR1C1 expression in human liver.

Western Blot: Aldo-keto Reductase 1C1/AKR1C1 Antibody [H00001645-B01P] - Analysis of AKR1C1 expression in transfected 293T cell line by AKR1C1 polyclonal antibody. Lane 1: AKR1C1 transfected lysate(35.53 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

Aldo-keto Reductase 1C1/AKR1C1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: AKR1C1 (NP_001344.2, 1 a.a. - 323 a.a.) full-length human protein. MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
• Specificity: AKR1C1 - aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: AKR1C1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aldo-keto Reductase 1C1/AKR1C1 Antibody

• 20 alpha-hydroxysteroid dehydrogenase
• 20-ALPHA-HSD
• 20-alpha-hydroxysteroid dehydrogenase
• 2-ALPHA-HSD
• AKR1C1
• Aldo-keto Reductase 1C1
• aldo-keto reductase family 1 member C1
• aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha(3-alpha)-hydroxysteroid dehydrogenase)
• AldoketoReductase 1C1
• C9
• Chlordecone reductase homolog HAKRC
• DD1/DD2
• DD1MGC8954
• DDH1
• DDHH-37
• dihydrodiol dehydrogenase 1
• Dihydrodiol dehydrogenase 1/2
• dihydrodiol dehydrogenase isoform DD1
• EC 1.1.1
• EC 1.1.1.-
• EC 1.1.1.112
• EC 1.1.1.149,2-ALPHA-HSD
• EC 1.3.1.20
• HAKRC
• HAKRCDDH1aldo-keto reductase C
• HBAB
• hepatic dihydrodiol dehydrogenase
• High-affinity hepatic bile acid-binding protein
• Indanol dehydrogenase
• MBAB
• Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
• type II 3-alpha-hydroxysteroid dehydrogenase

Background

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aldo-keto Reductase 1C1/AKR1C1 Antibody (H00001645-B01P)(5)

Publications using H00001645-B01P

• Kim D, Choi BH, Ryoo IG et al. High NRF2 level mediates cancer stem cell-like properties of aldehyde dehydrogenase (ALDH)-high ovarian cancer cells: inhibitory role of all-trans retinoic acid in ALDH/NRF2 signaling. Cell Death Dis 2018-08-30 [PMID: 30166520]
• Choi BH, Ryu DY, Ryoo IG et al. NFE2L2/NRF2 silencing-inducible miR-206 targets c-MET/EGFR and suppresses BCRP/ABCG2 in cancer cells. Oncotarget 2017-11-18 [PMID: 29291022]
• Choi BH, Ryoo IG, Kang HC, Kwak MK. The Sensitivity of Cancer Cells to Pheophorbide a-Based Photodynamic Therapy Is Enhanced by NRF2 Silencing. PLoS One. 2014-09-16 [PMID: 25226504]
• Han H, Bourboulia D, Jensen-Taubman S et al. An endogenous inhibitor of angiogenesis inversely correlates with side population phenotype and function in human lung cancer cells. Oncogene. 2014-02-27 [PMID: 23474755] (Human)
• Ebert B, Kisiela M, Wsol V et al. Proteasome inhibitors MG-132 and bortezomib induce AKR1C1; AKR1C3; AKR1B1; and AKR1B10 in human colon cancer cell lines SW-480 and HT-29. Chem Biol Interact 2011-01-06 [PMID: 21215737]

Bioinformatics

• Gene Symbol: AKR1C1
• Entrez:
  • 1645(Human)
• Uniprot:
  • NP_001344.2(Human)