Recombinant Human ALDH9A1 Protein

Images

 
SDS-Page: Recombinant Human ALDH9A1 Protein [H00000223-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ALDH9A1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-98 of Human ALDH9A1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMN

Protein/Peptide Type
Partial Recombinant Protein
Gene
ALDH9A1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALDH9A1 Protein

  • aldehyde dehydrogenase 9 family, member A1
  • Aldehyde dehydrogenase E3 isozyme
  • Aldehyde dehydrogenase family 9 member A1
  • ALDH4
  • ALDH7
  • ALDH9aldehyde dehydrogenase (NAD+)
  • E34-trimethylaminobutyraldehyde dehydrogenase
  • EC 1.2.1
  • EC 1.2.1.19
  • EC 1.2.1.3
  • EC 1.2.1.47
  • EC 1.2.1.8
  • Gamma-aminobutyraldehyde dehydrogenase
  • R-aminobutyraldehyde dehydrogenase
  • TMABADH

Background

ALDH9A1 - aldehyde dehydrogenase 9 family, member A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-97856
Species: Hu, Mu, Rt
Applications: WB
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31207
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00000223-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ALDH9A1 Partial Recombinant Protein (H00000223-Q01) (0)

There are no publications for ALDH9A1 Partial Recombinant Protein (H00000223-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH9A1 Partial Recombinant Protein (H00000223-Q01) (0)

There are no reviews for ALDH9A1 Partial Recombinant Protein (H00000223-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALDH9A1 Partial Recombinant Protein (H00000223-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALDH9A1 Products

Bioinformatics Tool for ALDH9A1 Partial Recombinant Protein (H00000223-Q01)

Discover related pathways, diseases and genes to ALDH9A1 Partial Recombinant Protein (H00000223-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH9A1 Partial Recombinant Protein (H00000223-Q01)

Discover more about diseases related to ALDH9A1 Partial Recombinant Protein (H00000223-Q01).
 

Pathways for ALDH9A1 Partial Recombinant Protein (H00000223-Q01)

View related products by pathway.

PTMs for ALDH9A1 Partial Recombinant Protein (H00000223-Q01)

Learn more about PTMs related to ALDH9A1 Partial Recombinant Protein (H00000223-Q01).

Blogs on ALDH9A1

There are no specific blogs for ALDH9A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ALDH9A1 Antibody
NBP1-89150

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALDH9A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH9A1