ALDH7A1 Antibody

Images

 
Western Blot: ALDH7A1 Antibody [NBP1-88908] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: ALDH7A1 Antibody [NBP1-88908] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: ALDH7A1 Antibody [NBP1-88908] - Staining of human kidney shows strong cytoplasmic positivity with a granular pattern in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALDH7A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH7A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALDH7A1 Protein (NBP1-88908PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALDH7A1 Antibody

  • aldehyde dehydrogenase 7 family, member A1
  • Aldehyde dehydrogenase family 7 member A1,26g turgor protein homolog
  • Alpha-AASA dehydrogenase
  • ATQ1Antiquitin-1
  • Betaine aldehyde dehydrogenase
  • Delta1-piperideine-6-carboxylate dehydrogenase
  • EC 1.2.1
  • EC 1.2.1.3
  • EC 1.2.1.31
  • EC 1.2.1.8
  • EPDalpha-aminoadipic semialdehyde dehydrogenase
  • FLJ11738
  • FLJ92814
  • P6c dehydrogenase
  • PDEantiquitin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-2462
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, PEP-ELISA
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83275
Species: Hu
Applications: IHC, IHC-P
AF1408
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IP
NBP1-88908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ALDH7A1 Antibody (NBP1-88908) (0)

There are no publications for ALDH7A1 Antibody (NBP1-88908).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH7A1 Antibody (NBP1-88908) (0)

There are no reviews for ALDH7A1 Antibody (NBP1-88908). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ALDH7A1 Antibody (NBP1-88908) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALDH7A1 Products

Bioinformatics Tool for ALDH7A1 Antibody (NBP1-88908)

Discover related pathways, diseases and genes to ALDH7A1 Antibody (NBP1-88908). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH7A1 Antibody (NBP1-88908)

Discover more about diseases related to ALDH7A1 Antibody (NBP1-88908).
 

Pathways for ALDH7A1 Antibody (NBP1-88908)

View related products by pathway.

PTMs for ALDH7A1 Antibody (NBP1-88908)

Learn more about PTMs related to ALDH7A1 Antibody (NBP1-88908).
 

Research Areas for ALDH7A1 Antibody (NBP1-88908)

Find related products by research area.

Blogs on ALDH7A1

There are no specific blogs for ALDH7A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALDH7A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH7A1