ALDH7A1 Antibody

Images

 
Western Blot: ALDH7A1 Antibody [NBP1-88908] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: ALDH7A1 Antibody [NBP1-88908] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ALDH7A1 Antibody [NBP1-88908] - Staining of human liver shows moderate positivity in cytoplasm granular in hepatocytes.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ALDH7A1 Antibody [NBP1-88908] - Analysis in human kidney and skeletal muscle tissues. Corresponding ALDH7A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ALDH7A1 Antibody [NBP1-88908] - Staining of human cerebral cortex shows moderate membranous positivity in microglia.
Immunohistochemistry-Paraffin: ALDH7A1 Antibody [NBP1-88908] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ALDH7A1 Antibody [NBP1-88908] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ALDH7A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH7A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALDH7A1 Protein (NBP1-88908PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALDH7A1 Antibody

  • aldehyde dehydrogenase 7 family, member A1
  • Aldehyde dehydrogenase family 7 member A1,26g turgor protein homolog
  • Alpha-AASA dehydrogenase
  • ATQ1Antiquitin-1
  • Betaine aldehyde dehydrogenase
  • Delta1-piperideine-6-carboxylate dehydrogenase
  • EC 1.2.1
  • EC 1.2.1.3
  • EC 1.2.1.31
  • EC 1.2.1.8
  • EPDalpha-aminoadipic semialdehyde dehydrogenase
  • FLJ11738
  • FLJ92814
  • P6c dehydrogenase
  • PDEantiquitin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02559
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-12242
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NB100-2462
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, PEP-ELISA, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NB300-639
Species: Hu, Mu, Rt
Applications: IP, WB
AF1408
Species: Hu, Rt
Applications: IHC, IP, KO, Simple Western, WB
NBP1-88908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ALDH7A1 Antibody (NBP1-88908) (0)

There are no publications for ALDH7A1 Antibody (NBP1-88908).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH7A1 Antibody (NBP1-88908) (0)

There are no reviews for ALDH7A1 Antibody (NBP1-88908). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ALDH7A1 Antibody (NBP1-88908) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALDH7A1 Products

Bioinformatics Tool for ALDH7A1 Antibody (NBP1-88908)

Discover related pathways, diseases and genes to ALDH7A1 Antibody (NBP1-88908). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH7A1 Antibody (NBP1-88908)

Discover more about diseases related to ALDH7A1 Antibody (NBP1-88908).
 

Pathways for ALDH7A1 Antibody (NBP1-88908)

View related products by pathway.

PTMs for ALDH7A1 Antibody (NBP1-88908)

Learn more about PTMs related to ALDH7A1 Antibody (NBP1-88908).
 

Research Areas for ALDH7A1 Antibody (NBP1-88908)

Find related products by research area.

Blogs on ALDH7A1

There are no specific blogs for ALDH7A1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALDH7A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH7A1