ALDH5A1 Recombinant Protein Antigen

Images

 
There are currently no images for ALDH5A1 Protein (NBP1-86997PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Binding Activity

Order Details

ALDH5A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALDH5A1.

Source: E. coli

Amino Acid Sequence: RKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALDH5A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86997.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ALDH5A1 Recombinant Protein Antigen

  • aldehyde dehydrogenase 5 family, member A1
  • EC 1.2.1
  • EC 1.2.1.24
  • NAD(+)-dependent succinic semialdehyde dehydrogenase
  • SSADHmitochondrial

Background

ALDH5A1 belongs to the aldehyde dehydrogenase family of proteins. This gene encodes a mitochondrial NAD(+)-dependent succinic semialdehyde dehydrogenase. A deficiency of this enzyme, known as 4-hydroxybutyricaciduria, is a rare inborn error in the metabolism of the neurotransmitter 4-aminobutyric acid (GABA). In response to the defect, physiologic fluids from patients accumulate GHB, a compound with numerous neuromodulatory properties. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21598
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
NBP1-87122
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP1-32828
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
NBP1-33284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37397
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF3998
Species: Hu
Applications: WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-02483
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86997PEP
Species: Hu
Applications: Binding Activity

Publications for ALDH5A1 Protein (NBP1-86997PEP) (0)

There are no publications for ALDH5A1 Protein (NBP1-86997PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH5A1 Protein (NBP1-86997PEP) (0)

There are no reviews for ALDH5A1 Protein (NBP1-86997PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ALDH5A1 Protein (NBP1-86997PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALDH5A1 Products

Bioinformatics Tool for ALDH5A1 Protein (NBP1-86997PEP)

Discover related pathways, diseases and genes to ALDH5A1 Protein (NBP1-86997PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH5A1 Protein (NBP1-86997PEP)

Discover more about diseases related to ALDH5A1 Protein (NBP1-86997PEP).
 

Pathways for ALDH5A1 Protein (NBP1-86997PEP)

View related products by pathway.

PTMs for ALDH5A1 Protein (NBP1-86997PEP)

Learn more about PTMs related to ALDH5A1 Protein (NBP1-86997PEP).
 

Research Areas for ALDH5A1 Protein (NBP1-86997PEP)

Find related products by research area.

Blogs on ALDH5A1

There are no specific blogs for ALDH5A1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ALDH5A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH5A1