ALDH3B2 Antibody - Azide and BSA Free

Western Blot: ALDH3B2 Antibody [NBP3-04930] - Western blot analysis of extracts of various cell lines, using ALDH3B2 antibody (NBP3-04930) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

• Reactivity: Hu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ALDH3B2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ALDH3B2 Antibody - Azide and BSA Free (NBP3-04930) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 296-385 of human ALDH3B2 (NP_000686.2). MLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALDH3B2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ALDH3B2 Antibody - Azide and BSA Free

• acetaldehyde dehydrogenase 8
• aldehyde dehydrogenase 3 family, member B2
• Aldehyde dehydrogenase 8
• ALDH8aldehyde dehydrogenase family 3 member B2
• EC 1.2.1
• EC 1.2.1.5

Background

The ALDH3B2 gene encodes a member of the aldehyde dehydrogenase family, a group of isozymes that may play a major role in thedetoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The gene of this particular familymember is over 10 k

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ALDH3B2