We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen

Images

 
There are currently no images for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen (NBP2-55797PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Aldehyde Dehydrogenase 3-A1/ALDH3A1.

Source: E. coli

Amino Acid Sequence: LHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALDH3A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55797.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen

  • aldehyde dehydrogenase 3 family, member A1
  • Aldehyde dehydrogenase 3
  • Aldehyde Dehydrogenase 3A1
  • Aldehyde Dehydrogenase 3-A1
  • Aldehyde dehydrogenase family 3 member A1
  • aldehyde dehydrogenase isozyme 3
  • aldehyde dehydrogenase type III
  • ALDH3A1
  • ALDH3aldehyde dehydrogenase, dimeric NADP-preferring
  • ALDHIII
  • EC 1.2.1
  • EC 1.2.1.5
  • MGC10406
  • stomach aldehyde dehydrogenase

Background

Aldehyde dehydrogenases oxidize various aldehydes to the corresponding acids. They are involved in the detoxification of alcohol-derived acetaldehyde and in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. The enzyme encoded by this gene forms a cytoplasmic homodimer that preferentially oxidizes aromatic and medium-chain (6 carbons or more) saturated and unsaturated aldehyde substrates. It is thought to promote resistance to UV and 4-hydroxy-2-nonenal-induced oxidative damage in the cornea. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5869
Species: Hu, Mu
Applications: ICC, IHC, IP, Simple Western, WB
NBP2-37397
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC,  IHC-P, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-01017
Species: Hu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00000126-D01P
Species: Hu, Mu
Applications: WB
H00000221-D01P
Species: Hu, Mu
Applications: WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-24722
Species: Hu
Applications: IHC,  IHC-P, In vitro, WB
NBP2-69822
Species: Hu
Applications: ELISA
NBP2-02563
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-00649
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-32569
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87158
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP1-84425
Species: Hu
Applications: IHC,  IHC-P

Publications for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen (NBP2-55797PEP) (0)

There are no publications for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen (NBP2-55797PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen (NBP2-55797PEP) (0)

There are no reviews for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen (NBP2-55797PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen (NBP2-55797PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aldehyde Dehydrogenase 3-A1/ALDH3A1 Products

Research Areas for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen (NBP2-55797PEP)

Find related products by research area.

Blogs on Aldehyde Dehydrogenase 3-A1/ALDH3A1

There are no specific blogs for Aldehyde Dehydrogenase 3-A1/ALDH3A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH3A1