We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

alcohol dehydrogenase 5 Recombinant Protein Antigen

Images

 
There are currently no images for alcohol dehydrogenase 5 Recombinant Protein Antigen (NBP2-49350PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

alcohol dehydrogenase 5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human alcohol dehydrogenase 5.

Source: E. coli

Amino Acid Sequence: GGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADH5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49350.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for alcohol dehydrogenase 5 Recombinant Protein Antigen

  • ADH-3
  • ADHXEC 1.1.1.1
  • alcohol dehydrogenase (class III), chi polypeptide
  • alcohol dehydrogenase 5 (class III), chi polypeptide
  • Alcohol dehydrogenase 5
  • Alcohol dehydrogenase class chi chain
  • alcohol dehydrogenase class-3
  • Alcohol dehydrogenase class-III
  • EC 1.1.1
  • EC 1.1.1.-
  • EC 1.1.1.284
  • FALDH
  • FDHGSNOR
  • formaldehyde dehydrogenase
  • Glutathione-dependent formaldehyde dehydrogenase
  • GSH-FDH
  • S-(hydroxymethyl)glutathione dehydrogenase

Background

The ADH5 gene encodes glutathione dependent formaldehyde dehydrogenase or class III alcohol dehydrogenase chi subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, retinol, ethanol and other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class III alcohol dehydrogenase is a homodimer composed of 2 chi subunits. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long chain primary alcohols and for oxidation of S hydroxymethyl glutathione, a spontaneous adduct between formaldehyde and glutathione. The enzyme is an important component of cellular metabolism for the elimination of formaldehyde, which is a potent irritant and sensitizing agent that causes rhinitis, lacrymation, contact dermatitis and pharyngitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-69822
Species: Hu
Applications: ELISA
NBP2-01017
Species: Hu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP2-50033
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, Simple Western, WB
NBP1-90233
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-00649
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP3-35880
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-03741
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-16374
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AF1936
Species: Hu
Applications: IP, WB
NBP2-62658
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-91942
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
NBP2-49350PEP
Species: Hu
Applications: AC

Publications for alcohol dehydrogenase 5 Recombinant Protein Antigen (NBP2-49350PEP) (0)

There are no publications for alcohol dehydrogenase 5 Recombinant Protein Antigen (NBP2-49350PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alcohol dehydrogenase 5 Recombinant Protein Antigen (NBP2-49350PEP) (0)

There are no reviews for alcohol dehydrogenase 5 Recombinant Protein Antigen (NBP2-49350PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for alcohol dehydrogenase 5 Recombinant Protein Antigen (NBP2-49350PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alcohol dehydrogenase 5 Products

Research Areas for alcohol dehydrogenase 5 Recombinant Protein Antigen (NBP2-49350PEP)

Find related products by research area.

Blogs on alcohol dehydrogenase 5

There are no specific blogs for alcohol dehydrogenase 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our alcohol dehydrogenase 5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADH5