alcohol dehydrogenase 4 Recombinant Protein Antigen

Images

 
There are currently no images for alcohol dehydrogenase 4 Protein (NBP1-90233PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

alcohol dehydrogenase 4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADH4.

Source: E.coli

Amino Acid Sequence: ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADH4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90233.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for alcohol dehydrogenase 4 Recombinant Protein Antigen

  • ADH-2
  • alcohol dehydrogenase 4 (class II), pi polypeptide
  • alcohol dehydrogenase 4
  • Alcohol dehydrogenase class II pi chain
  • aldehyde reductase
  • EC 1.1.1
  • EC 1.1.1.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02126
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88984
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02192
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29487
Species: Hu, Mu, Ha, Mk, Pm, Rb
Applications: IHC-P, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-67126
Species: Hu, Fi, Ze
Applications: WB, ICC/IF, IHC
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for alcohol dehydrogenase 4 Protein (NBP1-90233PEP) (0)

There are no publications for alcohol dehydrogenase 4 Protein (NBP1-90233PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alcohol dehydrogenase 4 Protein (NBP1-90233PEP) (0)

There are no reviews for alcohol dehydrogenase 4 Protein (NBP1-90233PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for alcohol dehydrogenase 4 Protein (NBP1-90233PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for alcohol dehydrogenase 4 Protein (NBP1-90233PEP)

Discover related pathways, diseases and genes to alcohol dehydrogenase 4 Protein (NBP1-90233PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alcohol dehydrogenase 4 Protein (NBP1-90233PEP)

Discover more about diseases related to alcohol dehydrogenase 4 Protein (NBP1-90233PEP).
 

Pathways for alcohol dehydrogenase 4 Protein (NBP1-90233PEP)

View related products by pathway.

PTMs for alcohol dehydrogenase 4 Protein (NBP1-90233PEP)

Learn more about PTMs related to alcohol dehydrogenase 4 Protein (NBP1-90233PEP).
 

Research Areas for alcohol dehydrogenase 4 Protein (NBP1-90233PEP)

Find related products by research area.

Blogs on alcohol dehydrogenase 4

There are no specific blogs for alcohol dehydrogenase 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our alcohol dehydrogenase 4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADH4