Alas1 Antibody (3G10)

Images

 
Western Blot: Alas1 Antibody (3G10) [H00000211-M01] - ALAS1 monoclonal antibody (M01), clone 3G10 Analysis of ALAS1 expression in JAR.
ELISA: Alas1 Antibody (3G10) [H00000211-M01] - Detection limit for recombinant GST tagged ALAS1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Alas1 Antibody (3G10) Summary

Immunogen
ALAS1 (NP_000679, 1 a.a. - 98 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
Specificity
ALAS1 - aminolevulinate, delta-, synthase 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ALAS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00000211-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Alas1 Antibody (3G10)

  • 5-aminolevulinic acid synthase 1
  • ALAS
  • ALAS3
  • ALASH
  • ALAS-H
  • aminolevulinate, delta-, synthase 1
  • Delta-ALA synthase 1,5-aminolevulinate synthase, nonspecific, mitochondrial
  • Delta-aminolevulinate synthase 1
  • EC 2.3.1
  • EC 2.3.1.37
  • MIG4
  • migration-inducing protein 4

Background

Delta-aminolevulinate synthase (ALAS; EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2 (MIM 301300).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000212-M01
Species: Hu, Mu
Applications: WB, ELISA
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-57136
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-85946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45995
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
MAB17791
Species: Hu, Mu
Applications: WB
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP

Publications for Alas1 Antibody (H00000211-M01)(1)

Reviews for Alas1 Antibody (H00000211-M01) (0)

There are no reviews for Alas1 Antibody (H00000211-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Alas1 Antibody (H00000211-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Alas1 Products

Bioinformatics Tool for Alas1 Antibody (H00000211-M01)

Discover related pathways, diseases and genes to Alas1 Antibody (H00000211-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alas1 Antibody (H00000211-M01)

Discover more about diseases related to Alas1 Antibody (H00000211-M01).
 

Pathways for Alas1 Antibody (H00000211-M01)

View related products by pathway.

PTMs for Alas1 Antibody (H00000211-M01)

Learn more about PTMs related to Alas1 Antibody (H00000211-M01).

Blogs on Alas1

There are no specific blogs for Alas1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Alas1 Antibody (3G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol ALAS1
Entrez
OMIM
Uniprot