AKT2 Antibody (1F3)

Images

 
Western Blot: Akt2 Antibody (1F3) [H00000208-M05] - Analysis of AKT2 expression in Jurkat (Cat # L017V1).
Immunocytochemistry/ Immunofluorescence: Akt2 Antibody (1F3) [H00000208-M05] - Analysis of monoclonal antibody to AKT2 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: Akt2 Antibody (1F3) [H00000208-M05] - Analysis of AKT2 expression in PC-12 (Cat # L012V1).
Western Blot: Akt2 Antibody (1F3) [H00000208-M05] - Analysis of AKT2 expression in Raw 264.7 (Cat # L024V1).
Western Blot: Akt2 Antibody (1F3) [H00000208-M05] - Analysis of AKT2 expression in NIH/3T3 (Cat # L018V1).
ELISA: Akt2 Antibody (1F3) [H00000208-M05] - Detection limit for recombinant GST tagged AKT2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AKT2 Antibody (1F3) Summary

Immunogen
AKT2 (AAA58364, 100 a.a. - 189 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII
Specificity
AKT2 (1F3)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AKT2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AKT2 Antibody (1F3)

  • Akt2
  • EC 2.7.11
  • EC 2.7.11.1
  • Murine thymoma viral (v-akt) homolog-2
  • PKB beta
  • PKBB
  • PKBBETA
  • PRKBB
  • Protein kinase Akt-2
  • Protein kinase B beta
  • rac protein kinase beta
  • RAC-beta serine/threonine-protein kinase
  • RAC-beta
  • RAC-PK-beta
  • v-akt murine thymoma viral oncogene homolog 2

Background

This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-80900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for AKT2 Antibody (H00000208-M05) (0)

There are no publications for AKT2 Antibody (H00000208-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKT2 Antibody (H00000208-M05) (0)

There are no reviews for AKT2 Antibody (H00000208-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AKT2 Antibody (H00000208-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKT2 Products

Bioinformatics Tool for AKT2 Antibody (H00000208-M05)

Discover related pathways, diseases and genes to AKT2 Antibody (H00000208-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKT2 Antibody (H00000208-M05)

Discover more about diseases related to AKT2 Antibody (H00000208-M05).
 

Pathways for AKT2 Antibody (H00000208-M05)

View related products by pathway.

PTMs for AKT2 Antibody (H00000208-M05)

Learn more about PTMs related to AKT2 Antibody (H00000208-M05).
 

Research Areas for AKT2 Antibody (H00000208-M05)

Find related products by research area.

Blogs on AKT2.

AKT Antibody Assays: A Complex Area with an Easy Solution
We at Novus Biologicals place a lot of emphasis on the kinase signaling pathways. Kinases, or phosphotransferase enzymes play a key role in phosphorylation signaling. Over 500 human protein kinases have so far been discovered. They play essential role...  Read full blog post.

The Akt Antibody Plays Many Roles in Cancer Research
There are three human isoforms of the AKT gene, which plays a key role in several signalling pathways. Akt antibody studies have shown the Atk kinases to play a diverse number of roles within the cell, regulating angiogenesis, apoptosis, protein synth...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKT2 Antibody (1F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol AKT2
Entrez
OMIM
Uniprot