Recombinant Human AKAP9 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AKAP9 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 3812-3911 of Human AKAP9 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EKTDSFYHSSGGLELYGEPRHTTYRSRSDLDYIRSPLPFQNRYPGTPADFNPGSLACSQLQNYDPDRALTDYITRLEALQRRLGTIQSGSTTQFHAGMRR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
AKAP9
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AKAP9 Protein

  • A kinase (PRKA) anchor protein (yotiao) 9
  • AKAP 350
  • AKAP 450
  • AKAP350A-kinase anchor protein 450 kDa
  • AKAP450A-kinase anchor protein 350 kDa
  • AKAP-9
  • Centrosome- and Golgi-localized PKN-associated protein
  • CG-NAPAKAP 120-like protein
  • hgAKAP 350
  • HYPERION
  • KIAA0803A-kinase anchor protein 9
  • MU-RMS-40.16A
  • PRKA9AKAP9-BRAF fusion protein
  • Protein hyperion
  • protein kinase A anchoring protein 9
  • Protein kinase A-anchoring protein 9
  • Protein yotiao
  • YOTIAOkinase N-associated protein

Background

AKAP9 - A kinase (PRKA) anchor protein (yotiao) 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, IF
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00010142-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for AKAP9 Partial Recombinant Protein (H00010142-Q01) (0)

There are no publications for AKAP9 Partial Recombinant Protein (H00010142-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP9 Partial Recombinant Protein (H00010142-Q01) (0)

There are no reviews for AKAP9 Partial Recombinant Protein (H00010142-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKAP9 Partial Recombinant Protein (H00010142-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AKAP9 Products

Bioinformatics Tool for AKAP9 Partial Recombinant Protein (H00010142-Q01)

Discover related pathways, diseases and genes to AKAP9 Partial Recombinant Protein (H00010142-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP9 Partial Recombinant Protein (H00010142-Q01)

Discover more about diseases related to AKAP9 Partial Recombinant Protein (H00010142-Q01).
 

Pathways for AKAP9 Partial Recombinant Protein (H00010142-Q01)

View related products by pathway.

PTMs for AKAP9 Partial Recombinant Protein (H00010142-Q01)

Learn more about PTMs related to AKAP9 Partial Recombinant Protein (H00010142-Q01).

Blogs on AKAP9

There are no specific blogs for AKAP9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AKAP9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP9