AKAP7 Antibody - BSA Free

Western Blot: AKAP7 Antibody [NBP1-89170] - Analysis in control (vector only transfected HEK293T lysate) and AKAP7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry: AKAP7 Antibody [NBP1-89170] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AKAP7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AKAP7 Antibody - BSA Free (NBP1-89170) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AKAP7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  AKAP7 Protein (NBP1-89170PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AKAP7 Antibody - BSA Free

• A kinase (PRKA) anchor protein 7
• AKAP 18
• AKAP15
• AKAP18A-kinase anchor protein 7 isoform alpha
• AKAP-7 isoform gamma
• AKAP-7 isoforms alpha and beta
• A-kinase anchor protein 18 kDa
• A-kinase anchor protein 7 isoform gamma
• A-kinase anchor protein 7 isoforms alpha and beta
• A-kinase anchor protein 7
• A-kinase anchor protein 9 kDa
• A-kinase anchor protein, 18-kD
• A-kinase anchoring protein 18
• protein kinase A anchoring protein 7
• Protein kinase A-anchoring protein 7 isoform gamma
• Protein kinase A-anchoring protein 7 isoforms alpha/beta

Background

AKAP7 encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AKAP7
• Entrez:
  • 9465(Human)
• Uniprot:
  • Q9P0M2(Human)