AKAP7 Antibody


Western Blot: AKAP7 Antibody [NBP1-89170] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry: AKAP7 Antibody [NBP1-89170] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

AKAP7 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNK
Specificity of human AKAP7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AKAP7 Protein (NBP1-89170PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for AKAP7 Antibody

  • A kinase (PRKA) anchor protein 7
  • AKAP 18
  • AKAP15
  • AKAP18A-kinase anchor protein 7 isoform alpha
  • AKAP-7 isoform gamma
  • AKAP-7 isoforms alpha and beta
  • A-kinase anchor protein 18 kDa
  • A-kinase anchor protein 7 isoform gamma
  • A-kinase anchor protein 7 isoforms alpha and beta
  • A-kinase anchor protein 7
  • A-kinase anchor protein 9 kDa
  • A-kinase anchor protein, 18-kD
  • A-kinase anchoring protein 18
  • protein kinase A anchoring protein 7
  • Protein kinase A-anchoring protein 7 isoform gamma
  • Protein kinase A-anchoring protein 7 isoforms alpha/beta


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Sh
Applications: WB (-), IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for AKAP7 Antibody (NBP1-89170) (0)

There are no publications for AKAP7 Antibody (NBP1-89170).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP7 Antibody (NBP1-89170) (0)

There are no reviews for AKAP7 Antibody (NBP1-89170). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKAP7 Antibody (NBP1-89170) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional AKAP7 Products

Bioinformatics Tool for AKAP7 Antibody (NBP1-89170)

Discover related pathways, diseases and genes to AKAP7 Antibody (NBP1-89170). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP7 Antibody (NBP1-89170)

Discover more about diseases related to AKAP7 Antibody (NBP1-89170).

Pathways for AKAP7 Antibody (NBP1-89170)

View related products by pathway.

PTMs for AKAP7 Antibody (NBP1-89170)

Learn more about PTMs related to AKAP7 Antibody (NBP1-89170).

Research Areas for AKAP7 Antibody (NBP1-89170)

Find related products by research area.

Blogs on AKAP7

There are no specific blogs for AKAP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AKAP7 Antibody and receive a gift card or discount.


Gene Symbol AKAP7