AKAP7 Antibody


Western Blot: AKAP7 Antibody [NBP1-53116] - HepG2 cell lysate, concentration 1.25ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

AKAP7 Antibody Summary

Synthetic peptides corresponding to AKAP7(A kinase (PRKA) anchor protein 7) The peptide sequence was selected from the middle region of AKAP7. Peptide sequence MKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSN.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against AKAP7 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AKAP7 Antibody

  • A kinase (PRKA) anchor protein 7
  • AKAP 18
  • AKAP15
  • AKAP18A-kinase anchor protein 7 isoform alpha
  • AKAP-7 isoform gamma
  • AKAP-7 isoforms alpha and beta
  • A-kinase anchor protein 18 kDa
  • A-kinase anchor protein 7 isoform gamma
  • A-kinase anchor protein 7 isoforms alpha and beta
  • A-kinase anchor protein 7
  • A-kinase anchor protein 9 kDa
  • A-kinase anchor protein, 18-kD
  • A-kinase anchoring protein 18
  • protein kinase A anchoring protein 7
  • Protein kinase A-anchoring protein 7 isoform gamma
  • Protein kinase A-anchoring protein 7 isoforms alpha/beta


AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Sh
Applications: WB (-), IP
Species: Hu
Applications: WB

Publications for AKAP7 Antibody (NBP1-53116) (0)

There are no publications for AKAP7 Antibody (NBP1-53116).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP7 Antibody (NBP1-53116) (0)

There are no reviews for AKAP7 Antibody (NBP1-53116). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKAP7 Antibody (NBP1-53116) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional AKAP7 Products

Bioinformatics Tool for AKAP7 Antibody (NBP1-53116)

Discover related pathways, diseases and genes to AKAP7 Antibody (NBP1-53116). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP7 Antibody (NBP1-53116)

Discover more about diseases related to AKAP7 Antibody (NBP1-53116).

Pathways for AKAP7 Antibody (NBP1-53116)

View related products by pathway.

PTMs for AKAP7 Antibody (NBP1-53116)

Learn more about PTMs related to AKAP7 Antibody (NBP1-53116).

Research Areas for AKAP7 Antibody (NBP1-53116)

Find related products by research area.

Blogs on AKAP7

There are no specific blogs for AKAP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AKAP7 Antibody and receive a gift card or discount.


Gene Symbol AKAP7