Recombinant Human AKAP4 Protein

Images

 
SDS-Page: Recombinant Human AKAP4 Protein [H00008852-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human AKAP4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human AKAP4

Source: Wheat Germ

Amino Acid Sequence: MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEEKEIIVIKDTEKKDQSKTEGSVCLF

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
AKAP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AKAP4 Protein

  • A kinase (PRKA) anchor protein 4
  • AKAP-4
  • AKAP82AKAP 82
  • A-kinase anchor protein 4
  • A-kinase anchor protein 82 kDa
  • cancer/testis antigen 99
  • CT99
  • hAKAP82Fsc1
  • HIFSC1
  • Major sperm fibrous sheath protein
  • p82
  • PRKA4
  • protein kinase A anchoring protein 4
  • Protein kinase A-anchoring protein 4
  • testis-specific gene HI

Background

AKAP4 - A kinase (PRKA) anchor protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76963
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-207
Species: Hu, Mu, Ce
Applications: WB, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NB100-1844
Species: Hu, Cm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88192
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13393
Species: Hu
Applications: WB, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
H00008852-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for AKAP4 Partial Recombinant Protein (H00008852-Q01) (0)

There are no publications for AKAP4 Partial Recombinant Protein (H00008852-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP4 Partial Recombinant Protein (H00008852-Q01) (0)

There are no reviews for AKAP4 Partial Recombinant Protein (H00008852-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKAP4 Partial Recombinant Protein (H00008852-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AKAP4 Products

Array H00008852-Q01

Bioinformatics Tool for AKAP4 Partial Recombinant Protein (H00008852-Q01)

Discover related pathways, diseases and genes to AKAP4 Partial Recombinant Protein (H00008852-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP4 Partial Recombinant Protein (H00008852-Q01)

Discover more about diseases related to AKAP4 Partial Recombinant Protein (H00008852-Q01).
 

Pathways for AKAP4 Partial Recombinant Protein (H00008852-Q01)

View related products by pathway.

PTMs for AKAP4 Partial Recombinant Protein (H00008852-Q01)

Learn more about PTMs related to AKAP4 Partial Recombinant Protein (H00008852-Q01).

Blogs on AKAP4

There are no specific blogs for AKAP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AKAP4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP4