AKAP3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

AKAP3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AKAP3
  
  

  Source: E.coli

  Amino Acid Sequence: FSHGSQKATDIMDAMLRKLYNVMFAKKVPEHVRKAQDKAESYSLISMKGMGDPKNRNVNFAMKSETKLREKMYSEPKSEEETCAKTLGEH

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: AKAP3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25270It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AKAP3 Recombinant Protein Antigen

• A kinase (PRKA) anchor protein 3
• AKAP110AKAP 110
• AKAP-3
• A-kinase anchor protein 110 kDa
• Cancer/testis antigen 82
• CT82A-kinase anchor protein 3
• Fibrous sheath protein of 95 kDa
• fibrousheathin 1
• Fibrousheathin I
• fibrousheathin-1
• FSP95A-kinase anchor protein, 110kDa
• PRKA3
• protein kinase A anchoring protein 3
• Protein kinase A-anchoring protein 3
• SOB1fibrous sheath protein, 95kDa
• sperm oocyte-binding protein 1
• Sperm oocyte-binding protein

Background

A-kinase anchor proteins (AKAPs) direct the activity of protein kinase A (PKA) by tethering the enzyme near its physiologic substrates. May function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction in sperm.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AKAP3