AKAP10 Antibody - BSA Free

Western Blot: AKAP10 Antibody [NBP1-56509] - RPMI 8226 cell lysate, concentration 0.2-1 ug/ml.

Western Blot: AKAP10 Antibody [NBP1-56509] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml AKAP10 is supported by BioGPS gene expression data to be expressed in HEK293T.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AKAP10 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human AKAP10 (NP_009133). Peptide sequence ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AKAP10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 71 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AKAP10 Antibody - BSA Free

• A kinase (PRKA) anchor protein 10
• AKAP-10
• A-kinase anchor protein 10, mitochondrial
• D-AKAP2
• D-AKAP-2
• Dual specificity A kinase-anchoring protein 2
• dual-specificity A-kinase anchoring protein 2
• MGC9414
• mitochondrial A kinase PPKA anchor protein 10
• PRKA10a kinase anchor protein 10, mitochondrial
• protein kinase A anchoring protein 10
• Protein kinase A-anchoring protein 10

Background

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA; therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AKAP10
• Entrez:
  • 11216(Human)
• Uniprot:
  • O43572(Human)