AKAP10 Antibody (8C10)

Images

 
Western Blot: AKAP10 Antibody (8C10) [H00011216-M04] - Analysis of AKAP10 expression in Raw 264.7.
Immunohistochemistry-Paraffin: AKAP10 Antibody (8C10) [H00011216-M04] - Analysis of monoclonal antibody to AKAP10 on formalin-fixed paraffin-embedded human testis. Antibody concentration 0.5 ug/ml
Western Blot: AKAP10 Antibody (8C10) [H00011216-M04] - Western blot analysis of AKAP10 over-expressed 293 cell line. Lane 2 cotransfected with AKAP10 Validated Chimera RNAi Lane 1 non-transfected control. Blot probed ...read more
Western Blot: AKAP10 Antibody (8C10) [H00011216-M04] - Analysis of AKAP10 expression in transfected 293T cell line by AKAP10 monoclonal antibody (M04), clone 8C10. Lane 1: AKAP10 transfected lysatE (73.8 KDa). Lane 2: ...read more
Sandwich ELISA: AKAP10 Antibody (8C10) [H00011216-M04] - Detection limit for recombinant GST tagged AKAP10 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
Clone
8C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AKAP10 Antibody (8C10) Summary

Immunogen
AKAP10 (NP_009133, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEA
Specificity
AKAP10 - A kinase (PRKA) anchor protein 10
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AKAP10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation, and ELISA.
Publications
Read Publication using H00011216-M04.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AKAP10 Antibody (8C10)

  • A kinase (PRKA) anchor protein 10
  • AKAP-10
  • A-kinase anchor protein 10, mitochondrial
  • D-AKAP2
  • D-AKAP-2
  • Dual specificity A kinase-anchoring protein 2
  • dual-specificity A-kinase anchoring protein 2
  • MGC9414
  • mitochondrial A kinase PPKA anchor protein 10
  • PRKA10a kinase anchor protein 10, mitochondrial
  • protein kinase A anchoring protein 10
  • Protein kinase A-anchoring protein 10

Background

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA; therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15319
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76526
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
NB400-149
Species: Hu, Mu, Bv, Rt(-)
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89168
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56659
Species: Hu, Mu, Rt
Applications: WB
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47935
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02520
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00011216-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA

Publications for AKAP10 Antibody (H00011216-M04)(1)

Reviews for AKAP10 Antibody (H00011216-M04) (0)

There are no reviews for AKAP10 Antibody (H00011216-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AKAP10 Antibody (H00011216-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AKAP10 Products

Bioinformatics Tool for AKAP10 Antibody (H00011216-M04)

Discover related pathways, diseases and genes to AKAP10 Antibody (H00011216-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP10 Antibody (H00011216-M04)

Discover more about diseases related to AKAP10 Antibody (H00011216-M04).
 

Pathways for AKAP10 Antibody (H00011216-M04)

View related products by pathway.

PTMs for AKAP10 Antibody (H00011216-M04)

Learn more about PTMs related to AKAP10 Antibody (H00011216-M04).

Blogs on AKAP10

There are no specific blogs for AKAP10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKAP10 Antibody (8C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP10
Entrez
OMIM
Uniprot