Aiolos/IKZF3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: AVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IKZF3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Aiolos/IKZF3 Antibody - BSA Free
Background
IKZF3 encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers. At least six alternative transcripts encoding different isoforms have been described. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC, IHC, mIF, Simple Western, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IP, Neut, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for Aiolos/IKZF3 Antibody (NBP1-89185) (0)
There are no publications for Aiolos/IKZF3 Antibody (NBP1-89185).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Aiolos/IKZF3 Antibody (NBP1-89185) (0)
There are no reviews for Aiolos/IKZF3 Antibody (NBP1-89185).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Aiolos/IKZF3 Antibody (NBP1-89185) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Aiolos/IKZF3 Products
Research Areas for Aiolos/IKZF3 Antibody (NBP1-89185)
Find related products by research area.
|
Blogs on Aiolos/IKZF3