Aiolos/IKZF3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Aiolos/IKZF3 Antibody [NBP1-89185] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry: Aiolos/IKZF3 Antibody [NBP1-89185] - Staining of human tonsil shows distinct nuclear positivity in most cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aiolos/IKZF3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IKZF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000-1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Aiolos/IKZF3 Recombinant Protein Antigen (NBP1-89185PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aiolos/IKZF3 Antibody

  • AIO
  • Aiolos
  • IKAROS family zinc finger 3 (Aiolos)
  • Ikaros family zinc finger protein 3
  • IKZF3
  • zinc finger protein Aiolos
  • ZNFN1A3
  • ZNFN1A3subfamily 1A, 3 (Aiolos)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NBP2-34122
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45374
Species: Hu
Applications: WB, IHC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF5165
Species: Hu, Mu
Applications: WB
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
20650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-82689
Species: Hu
Applications: WB, IHC, IHC-P
AF3487
Species: Hu
Applications: WB, IHC, ICC
NBP2-55305
Species: Hu
Applications: WB, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB7650
Species: Mu
Applications: WB, IHC
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-34099
Species: Hu
Applications: IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Aiolos/IKZF3 Antibody (NBP1-89185) (0)

There are no publications for Aiolos/IKZF3 Antibody (NBP1-89185).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aiolos/IKZF3 Antibody (NBP1-89185) (0)

There are no reviews for Aiolos/IKZF3 Antibody (NBP1-89185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Aiolos/IKZF3 Antibody (NBP1-89185) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aiolos/IKZF3 Products

Bioinformatics Tool for Aiolos/IKZF3 Antibody (NBP1-89185)

Discover related pathways, diseases and genes to Aiolos/IKZF3 Antibody (NBP1-89185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aiolos/IKZF3 Antibody (NBP1-89185)

Discover more about diseases related to Aiolos/IKZF3 Antibody (NBP1-89185).
 

Pathways for Aiolos/IKZF3 Antibody (NBP1-89185)

View related products by pathway.

PTMs for Aiolos/IKZF3 Antibody (NBP1-89185)

Learn more about PTMs related to Aiolos/IKZF3 Antibody (NBP1-89185).
 

Research Areas for Aiolos/IKZF3 Antibody (NBP1-89185)

Find related products by research area.

Blogs on Aiolos/IKZF3

There are no specific blogs for Aiolos/IKZF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aiolos/IKZF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IKZF3
Entrez