AICL Antibody

Images

 
Immunohistochemistry: AICL Antibody [NBP1-90204] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AICL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICRKR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLEC2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AICL Protein (NBP1-90204PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AICL Antibody

  • Activation-induced C-type lectin
  • AICL
  • AICLC-type lectin superfamily member 2
  • CLEC2B
  • CLEC-2B
  • CLECSF2
  • CLECSF2IFN-alpha-2b-inducing-related protein 1
  • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 2 (activation-induced)
  • C-type lectin domain family 2 member B
  • C-type lectin domain family 2, member B
  • HP10085
  • IFN-alpha2b-inducing related protein 1
  • IFNRG1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1718
Species: Hu, Mu, Rt
Applications: WB
NB600-1015
Species: Mu, Hu(-)
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
MAB1900
Species: Hu
Applications: Flow, CyTOF-ready
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
NB100-77528
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00029121-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-25236
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB1059
Species: Hu
Applications: Flow, CyTOF-ready
MAB2238
Species: Hu
Applications: Flow, AgAct, CyTOF-reported
NBP1-76941
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76983
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP

Publications for AICL Antibody (NBP1-90204) (0)

There are no publications for AICL Antibody (NBP1-90204).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AICL Antibody (NBP1-90204) (0)

There are no reviews for AICL Antibody (NBP1-90204). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AICL Antibody (NBP1-90204) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AICL Products

Bioinformatics Tool for AICL Antibody (NBP1-90204)

Discover related pathways, diseases and genes to AICL Antibody (NBP1-90204). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AICL Antibody (NBP1-90204)

Discover more about diseases related to AICL Antibody (NBP1-90204).
 

Pathways for AICL Antibody (NBP1-90204)

View related products by pathway.

PTMs for AICL Antibody (NBP1-90204)

Learn more about PTMs related to AICL Antibody (NBP1-90204).

Blogs on AICL

There are no specific blogs for AICL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AICL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLEC2B
Entrez